SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111220561|ref|YP_711355.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111220561|ref|YP_711355.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.57e-34
Family Ribosomal protein L6 0.0000549
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.63e-26
Family Ribosomal protein L6 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111220561|ref|YP_711355.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Frankia alni ACN14a]
Sequence
MSRIGRLPIPVPSGVDITVEGATVTVKGPKGTLSHVVVEPIAVNREEGQLVVTRPDDERR
SRSLHGLTRTLVSNMVTGVTAGYSKTLEIVGVGYRVQAKGSDLEFALGYSHPVPVKAPEG
IRFEVQTPTRFVVHGIDKQLVGEVSAKIRGLRKPDPYKGKGVRYQGEVVRRKVGKTGK
Download sequence
Identical sequences Q0RRQ6
WP_011602310.1.38265 326424.FRAAL1096 gi|111220561|ref|YP_711355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]