SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111222278|ref|YP_713072.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111222278|ref|YP_713072.1|
Domain Number 1 Region: 2-258
Classification Level Classification E-value
Superfamily Cgl1923-like 1.57e-83
Family Cgl1923-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111222278|ref|YP_713072.1|
Sequence length 280
Comment hypothetical protein FRAAL2860 [Frankia alni ACN14a]
Sequence
MIEFSGVGQLRSPVVVAAFEGWNDAADASSAAVEHLETAFKARVIGAIDPDDYYDFQVNR
PTVSGTDGASRKITWPTTRLSVARPPKSETDLVLIRGLEPNMRWRGFTDELIEAVHALGS
DMVISLGALLADSPHTRPVPISGTAGDAATAARLGLEPSRYEGPTGIVGVFGDACARAEL
ASVSFWAAVPHYVANPPCPKATLALLRRVEDLLDIEIPLGDLPERAKAWERQVDELAAGD
TEVAEYVRSLESREPETALPEASGDAIAREFERYLRRRGQ
Download sequence
Identical sequences A0A0D8BFS2 Q0RLV0
WP_011604006.1.38265 WP_011604006.1.52646 WP_011604006.1.98738 gi|111222278|ref|YP_713072.1| 326424.FRAAL2860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]