SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111222769|ref|YP_713563.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111222769|ref|YP_713563.1|
Domain Number 1 Region: 571-654
Classification Level Classification E-value
Superfamily PKD domain 0.00000209
Family PKD domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111222769|ref|YP_713563.1|
Sequence length 675
Comment hypothetical protein FRAAL3354 [Frankia alni ACN14a]
Sequence
MPYIDEDEQRSEPVEHRYVHGGFEGTSTRFAICYPPAARWQGRLFQPLEGANAGHENVNT
GPLGQVTGGLEMIFRMGGYAVESNMGHIGDVMDPKAGPDPTIYGYRAAAESARFAKFVAA
QIYGAPTAYAYVYGGSGGARRSPLCLAYAPDVWDAALPYMGDAQDGDYGDLRLLRNGTPN
FSSMFNVQRVLGERINDVIDAMWPGGSGDPYAGLNTHQREELANVYRIGYPRGDESFIAQ
PMGQMWLWSSMATRLQADYPHYWENFWTRPGHVGFDQPELVRDDLIELDTTVKRVLYAKD
LLEDPTLQTPELGQVRALASLFAAMNNMWHIPMAVQLDEAPDGYILGASVELTSGAAAGR
ILYVLNGHRDVLLVDSDGEAANLRFSGVEPGDRIRVDNHAFLAYCYYYRHHILPWEPEYD
FLRVDGQPIYQQYELPEMSPFMGVRHTGRIEGKLLWVHHTHDSSLWPPQGLGFKANIERE
YGVELARTKFRLRWTENAEHVPPNMAASVPGRANTTYLVDYQPIIEQSLADLVDWVENGV
EPVDTEYDYRDGAIVLPATAKERRGIQPVVSVTANGGARAEVAVGEPVTLSAHAETPPGA
GSIIGIRWDFDGQGTFPRTEDLDGSPAEVTVTTTHAYDAPGTYFATALVESHRDGDATAT
SRRIPNLASARIIVR
Download sequence
Identical sequences Q0RKG0
gi|111222769|ref|YP_713563.1| 326424.FRAAL3354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]