SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111223424|ref|YP_714218.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111223424|ref|YP_714218.1|
Domain Number 1 Region: 58-314
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-59
Family Protein kinases, catalytic subunit 0.0000491
Further Details:      
 
Weak hits

Sequence:  gi|111223424|ref|YP_714218.1|
Domain Number - Region: 509-568
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 329-378
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.05
Family gamma-carbonic anhydrase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111223424|ref|YP_714218.1|
Sequence length 687
Comment Serine/threonine protein kinase [Frankia alni ACN14a]
Sequence
MLAPEILGAAFPNIVCVLGVLREVHGPVLADSGGQAVRSPAVLPDGVTELEDDDPPALGP
YRLFGRLGEGGMGTVFLAWNPAGGWVAAKTLHRHLARQADFLARFAREVDNARRINSPYT
PSVLDADTATRDPYLVTEFIAGPTLSQEIRTRGPLSRSELHQLALNLASAMLAFHRVGIV
HRDIKPANIILSRTGPRVIDLGISRALNEAVGITVSSGQQPGTPQLMAPEQWTGQRPTPA
TDVFAWGSVLTYAGTGRFPFAGVDHRELRDAVLHSRPATNGLDASLRPLILRALAKDPAA
RPDVADLLADLLGGAAPLAAAGIEATPVSNATLISNPTPVSNPTPVSDATLISNATLGGN
AALGSQATLGIGAGVTEIPPVAAPPVTDESVTAHAEPDSAVRRGRRPGRRLTVLAGTLAI
AAVITVVALLIHRTTSPSRPANAAVPDGLVGLPVTRAKASLQSAGFRQITQTRRPDDRAR
GTVLAVRPQSGDVVRADSPVVLTVSAGRSAVAVPNVVGRSQSDAETVLRRSNLAVTAQIS
TAVRAGAPPGWVEAQDHAGEKVEPGTEVTITVVSLQLPVPDVVGQPARTAVEQLTDAGFQ
VTREERRSDAAVGTVIDQQPRITAADRGSDVRLVVSAGRPAQTAPPRPTAPRNVTPRATA
PRTTTPRATTTHAPTPRLTGLFSDPLG
Download sequence
Identical sequences Q0RIK6
WP_011605151.1.38265 gi|111223424|ref|YP_714218.1| 326424.FRAAL4020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]