SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111223459|ref|YP_714253.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111223459|ref|YP_714253.1|
Domain Number 1 Region: 614-701
Classification Level Classification E-value
Superfamily PKD domain 0.00000131
Family PKD domain 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|111223459|ref|YP_714253.1|
Domain Number - Region: 145-210,489-567
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.034
Family DPP6 catalytic domain-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111223459|ref|YP_714253.1|
Sequence length 736
Comment hypothetical protein FRAAL4056 [Frankia alni ACN14a]
Sequence
MTRARMFCDAAAPTAGEARGRRRRSCLMGAIDLSGYEVTDAFFGAPFIEVDEQRERPSPH
RFVQGGFAGTDTEFAFYLPPAEYYTGRMFQPLEGGNGGHAVTFGGGILGEMFQRIDMSAR
LGGYMVESNQGHKGDDYDPKAGEDPTLYGHRASAEAARLSKYVAAQVYGSAPHHSYVWGG
SGGGRRSPLCLENAPGVWDGCMPSTSGGEIAEPGNTERVKAGSIMSFGQMFNVQRLLGRD
RIIALADRMAPGGSGDPFAGLGTHEREELASLYRQGFPRGNEFMISEPMGQMWLWTSLAD
ELHREDPDYFANFWTKPGYVGHDSPELVEADLIHQTGRVVRTLSARDLNESADFAGPEFQ
TMRILAAIVGAGGEAYEFPYAVEIEGLKGGYRVGAGVKVLTGKAAGRSLYATGAAGDVFA
CDGQGDANVLRFTGVEPGDEVLVDNRRFLAYCYFARHHVMADPAFAHLLVDGRPIYPQHP
VPRMSSLMGVCYSGQYEGKVLWLHHTHDSSVWPAWGTLYDRAVRQAQGEAGARANFRIRW
TEYAEHGPYGMVPPEPNRVAATRLIDFRGITEQSMIDLIDWVENGVEPNGSHYTFVDGRV
HLPSSAAQRGGIQPVASVTANGGARADVGVGEPVTLTVTAAVPPGAGRIIAVEWDFDGTG
TYPLRHAGIDGTAAELTVSTTHAYDRPGTYFATARVTSHRTGDVAAQRCRIETIAQARTV
VAAPAAPAPSAAGTEA
Download sequence
Identical sequences Q0RIH1
gi|111223459|ref|YP_714253.1| WP_011605186.1.38265 326424.FRAAL4056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]