SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111224399|ref|YP_715193.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111224399|ref|YP_715193.1|
Domain Number 1 Region: 86-131,167-193
Classification Level Classification E-value
Superfamily PA domain 0.0000157
Family PA domain 0.018
Further Details:      
 
Domain Number 2 Region: 14-63,274-490
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.0000518
Family Bacterial dinuclear zinc exopeptidases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111224399|ref|YP_715193.1|
Sequence length 513
Comment hypothetical protein FRAAL5013 [Frankia alni ACN14a]
Sequence
MMTGPSRSGGLNSQGALWEAVERMVSFGPRLPGSPAHHRHIDDLDAQLRRLGLAVTRHPV
PLARWLADDWALRVVDARGVSVTVPVASYRPYSGETSTRGVTATVVDVGAGGAADYRGRS
VAGAIVLADAPVARLPAAVLTDLADAVEPPDARALLAAEDYSRVWLGVPAPPDLALARRH
GALAMIEILDLPPALAAGQYTPHQQPYAGLPTLHVDREQGARLRALLAAGPLRATVVLTA
RHDDSSVDYLLARLPDSDRDRDCSPDPDCSPDPDPECGADRNRDPDPRGSARAGGDVLVA
THTDGQNAIEENGGPALLALAERLARRGPAARRRRDAVFLFSPAHMTADAATVKPDAWLR
RHPRLRDRLAMALVAEHLGATGWDEGGGTVPYGPTGRSEPVVVAVGHSERLRRLALDEVR
AGGLTRAAVLPPAADGLYGEGTFPYRLGLPTAAFISGPAYLLQVGPGDQLDKLDPALLHR
HTVFLARLLDRMLAQPHIDRAGNSSAQRAQKGA
Download sequence
Identical sequences Q0RFT8
gi|111224399|ref|YP_715193.1| 326424.FRAAL5013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]