SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111224466|ref|YP_715260.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111224466|ref|YP_715260.1|
Domain Number 1 Region: 31-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-70
Family Protein kinases, catalytic subunit 0.00000776
Further Details:      
 
Domain Number 2 Region: 690-748
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000379
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|111224466|ref|YP_715260.1|
Domain Number - Region: 467-529
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111224466|ref|YP_715260.1|
Sequence length 755
Comment Serine/threonine-protein kinase PK-1 [Frankia alni ACN14a]
Sequence
MAPVAAWFGNDRKLSPVDATVADPVIGRLLDGRYTAQERLAVGGMATVYVAHDNRLDRLV
ALKVMHPNLNHDPEFVGRFHREAKAVARLNTPRVVSVLDQGSDHTSAGLINYLVMELVRG
RSLRQHLGARGRLSVAEAVEIIEPVMEALAAAHDAGIIHRDIKPENILLGDDGQVKVADF
GLARPLGQPTQALTDGVVMGTVGYLAPEQVTLGTADTRSDVYAAGVVLFESLTGHLPHSG
ATPMSMAYQSVHGDVPAPSTIVEGVPAELDGLVLRATARDPARRPADGAALLDELHRIGP
YLPAPDSYQTGFTGEVERIGLMAPPPEDPGPDHTRPFQPTDYDNDYNTGYGADHDTGYDG
PHGAAGFTGAEAGRPRAGIAEHDSAAGAPYAGGVASQPGTGALYRSAAAPTPTSTSYLGA
GHGRRRAAGPGSGAGPRRYLPLAVGGAAILVLLIGFLAVRMLSSDKVEVPLLTSVSKSDA
ETMLRDAGLKATYLDPIASPKVAAGHVAQQDPRDGTKVDKGAVITLRLSSGPATVPVPDL
ANLTRDQAAARLNEVNLAVGGQINQASDTVPAGHVIGTNPAVNTVLKPRDGVTLIMSSGP
DTRQMPADVIGKPYDAAKAEIDALGVAGVTVQRDLAVTEDTPAGNVVGAAPGVGQPIAPN
TVVTLTVATAPDDGTDTSGTSDGGDGSGVQVVVPKVVGKTYREAEGILAQRGLKIDRFAP
FGKPNDRVTAQSAQPNSKIEKGSTVHVNTVWQLGN
Download sequence
Identical sequences Q0RFM1
gi|111224466|ref|YP_715260.1| 326424.FRAAL5081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]