SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111224576|ref|YP_715370.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111224576|ref|YP_715370.1|
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.54e-17
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 92-148
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 5.23e-17
Family C-terminal domain of arginine repressor 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111224576|ref|YP_715370.1|
Sequence length 243
Comment arginine repressor ArgR [Frankia alni ACN14a]
Sequence
MGAGVRRAAPLTKHARQARLAALIAQRPVRSQSELARLLATEGVQVTQATLSRDLEEIGA
TKVRGADGGLVYAVDVNLAPAEIVRLPLTRLCEELLVSAEANGDLVVLRTPPGAAQLFAS
ALDREALPAVMGTIAGDDTVLVVCRAQLPAPAGGSISETTPAGGQSAGEASPTGPSAGQP
PVPGGPGLAAHLLRLADGRARAVPGVAAAAQARPRTPPAGGAVLAGTGGGTGTPDDDLPR
NPT
Download sequence
Identical sequences Q0RFB1
gi|111224576|ref|YP_715370.1| 326424.FRAAL5203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]