SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|430749117|ref|YP_007212025.1| from Thermobacillus composti KWC4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|430749117|ref|YP_007212025.1|
Domain Number 1 Region: 206-334
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 4.08e-51
Family Peptidoglycan hydrolase LytM 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|430749117|ref|YP_007212025.1|
Sequence length 342
Comment metalloendopeptidase-like membrane protein [Thermobacillus composti KWC4]
Sequence
MRLLPGWFRRRYTLLIIPEDSDASSRVRLTIVPLLLAGAVFGLLVASAIILLALRSADAL
RIQALHKELAESADAYEASLADREQSIALLKSEVLRLTEEAGAVRQKLEELDKLEAEIEA
IVEIALPGETNGLASTSAGRKTAVTPLSYDVGVGGENHPVDEDGLAETEAYGSVELMTSL
KYEAELLRARLAAKKEEADRVLDKLRMLPIAWPTDSTRLTSEFGLRSDPFTRRLARHSGI
DLGGNSGEPVYAAGGGTVMESDYNRSRGHYIIIEHESGYKSVYMHLRKRLAGAGQKVEQG
EKIGLLGSSGRSTGPHLHFEIWKDGQAVDPLPYLQLFKEEKS
Download sequence
Identical sequences L0EB38
WP_015253786.1.55944 gi|430749117|ref|YP_007212025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]