SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|430750731|ref|YP_007213639.1| from Thermobacillus composti KWC4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|430750731|ref|YP_007213639.1|
Domain Number 1 Region: 186-309
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 5.75e-21
Family Peptidoglycan hydrolase LytM 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|430750731|ref|YP_007213639.1|
Sequence length 314
Comment membrane-bound metallopeptidase [Thermobacillus composti KWC4]
Sequence
MARVSGVKRRRAERIRAILEANQSETDADGIRPASVNPDGIPVTGGVTGDRVSVHGSVSG
GRASAPRPAALPQDRAERDPETEWKQRSREWLAASGRGRAPGLIDGEEPRQRGGMIRSLM
VRLAVAAVLFAAVWGLFRLDEPWASAPQRLIARALTEDMDTRAAAEWYQRTFTGSPAFIP
IFGQEGERTEVGPGLPVAAPVASGEIVRSFAETLAGIEIAGKPGSIVTAAETGRVTHVTG
GENEGYSVVIRHAGKRMTVYGRMKSVFVAPDDWVEAGDRIGVLPETEDGSRSLLYFAVRV
DGKYVDPADVVPLD
Download sequence
Identical sequences L0EG30
gi|430750731|ref|YP_007213639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]