SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111220473|ref|YP_711267.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111220473|ref|YP_711267.1|
Domain Number 1 Region: 20-333
Classification Level Classification E-value
Superfamily FMN-binding split barrel 3.92e-113
Family UbiD middle domain-like 0.0000000957
Further Details:      
 
Domain Number 2 Region: 334-499
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.05e-52
Family UbiD C-terminal domain-like 0.0000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111220473|ref|YP_711267.1|
Sequence length 499
Comment 3-polyprenyl-4-hydroxybenzoate decarboxylase [Frankia alni ACN14a]
Sequence
MVGARTAGRAGCQDGGMAWADLRAFLAHLERRKDLRRISVPVDPHLEVTEIVTRVVRERG
PALLFESPRGADMPLAINLFGTEARMATALGVDRLDEIGDRLAALLRPELPTGLSGLRDA
LGKAASLTSIPPRRVRTAPCQDVVLKGPDVDLFRLPGVHAWPNDGGAFLNLGLTHTRHPE
TGARNLGMYRLQRHDARTVGMHWQIHKDSNAHHAVAERRGERLPVAIAFGCDPAVTYAAS
APLPADIDEYLFAGYLRGERVEMVDCLSVPLRVPANAQIVLEGWLEPGARLPEGPFGDHT
GFYTPVEPFPALHVDVMTMQRDPVFQTIVVGRPPQEDGPMGKATERIFRPLIKMMIPEIV
DYDLPEAGVFHNCCIVSIDKRFPKHAQKVMNAVWGAGLLSLSKLIVVVDADCDVHDYAEV
AWRAFGNVDYAHDLITTIGPVDHLDHASYEQFWGGKVGVDATRKLPTEGYRREGGWPEEI
VMDDAVRAQVTRRWKEYGL
Download sequence
Identical sequences Q0RRZ4
326424.FRAAL1006 gi|111220473|ref|YP_711267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]