SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Tulca1|20236|gm1.3791_g from Tulasnella calospora AL13/4D v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Tulca1|20236|gm1.3791_g
Domain Number 1 Region: 114-335
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.36e-58
Family Mismatch glycosylase 0.0000806
Further Details:      
 
Domain Number 2 Region: 370-509
Classification Level Classification E-value
Superfamily Nudix 0.000000000000568
Family MutY C-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Tulca1|20236|gm1.3791_g
Sequence length 519
Sequence
MSRKSTRTVKAIHYTGLDVEEEIVELDTRPAKKRKTNGKRVIGDDDFTNISSGEDDITEF
EPTKKRGTKGPKPKDKKLKTKKRSLDDSEVDDELAVAGVSIPHSKSLHNGAKVKPLTGSL
LEWFDSVRDTRGMPWRKEYDPSLSEDEKAQRAYEVLVSEIMLQQTQVSTVIRYYNAWLER
FPTIKDLADVTDIEEVNALWKGLGYYRRAKALLEASKKVVKDFDGRIPKDVAVMEKEVPG
VGRYTAGAVCSIAYGVKAPAVDGNVQRLFSRLLAIHAQPKKAALDLIWNAASKLVETTDR
PGDLNQALIELGSTICKPQNPACGNCPLKDGCAAYRLANEKAADTVPDIEDMCNVCEPFP
DDGKAVTRFPMKVIKKAQRREASVVTVLQVEFAGEEWLLMSQRPAKGLLAGLWEFPTTDL
PEEEPGLPERLKATRTVVKKALPQMVSKDILPVVVGDFLHLFSHIRKTYFVVLVTISLDL
LPSANDGSKWVKPDDVGSMNVGKSSEKVWTMISNHLSSI
Download sequence
Identical sequences A0A0C3MAJ7
jgi|Tulca1|20236|gm1.3791_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]