SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126207594|ref|YP_001052819.1| from Actinobacillus pleuropneumoniae serovar 5b str. L20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126207594|ref|YP_001052819.1|
Domain Number 1 Region: 558-1010
Classification Level Classification E-value
Superfamily ALDH-like 1.17e-123
Family ALDH-like 0.000000546
Further Details:      
 
Domain Number 2 Region: 181-523
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.63e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000179
Further Details:      
 
Domain Number 3 Region: 15-180
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 4.84e-61
Family N-terminal domain of bifunctional PutA protein 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126207594|ref|YP_001052819.1|
Sequence length 1201
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Actinobacillus pleuropneumoniae serovar 5b str. L20]
Sequence
MPTNIYPLLPSSAVLRENISRHYRIDEAELVQQLLIEAETETLQPEIKNLARKLIEKVRT
NRQKASGVDALMHEFSLSSQEGIALMCLAEALLRIPDQVTRDKLIKDKIAKGDWKSHIGN
SPSLFVNASAWGLVFTGKLLSLNQQALSSSLNQLISKAGEPVIRKGIDFAMRLLGKQFVT
GETIQLALKNSEARFNKGFRFTYDMLGESAFTEQDAQHYYQDYVNSIHAVGAASKGLGVY
HSSGVSVKLSAIHPRYSLAQYDRVMDELYPRLRDLFLLAKRYNIGLNIDAEEANRLEISL
DLIDRLLSEPELADFDGIGIVVQAYQKRCRSVIDYLIAKARENNRKLMIRLVKGAYWDSE
VKLAQTESASGYPVFTRKVHTDLNYVACAKKLLAAQDVVFPQFATHNAQTLATIYHLAKG
KRFEFQCLHGMGETLYDQVVGKENLNIQCRVYAPVGSYQTLLAYLVRRLLENGSNSSFVN
QIVDENVSIDKLLEDPVAKAGITAGTMHPKTPLPIKLFADRKNSAGYELSDMHHLVQLGA
QLNALADHNQYRAVPQIAEQFYQGSQRKVIYNPADQTQIVGEVTYANETDVEKAFAIAEQ
NQTAWQATPAEQRAAILEKIADLMESNMPTLFDLAVREAGKTLNNAIAEVREAVDFCRYY
ANQVKRNPQAYQNPRGIIVAISPWNFPLAIFTGEVVSALVAGNVVLAKPAEQTSLMAHYA
VELFYQAGVPKSVLQCLPGSGAEIGNKLTADPRVDGVIFTGSTETAKTINRNLQKHSKII
PLIAETGGQNALIMDSSALGEQVVADVLNSAFDSAGQRCSALRVLYLQEDVADHILTMLK
GAMAELRVGKPQLLNTDIGPVIDRTAQSRLLAHIEKMKAVAKSYYQVPIAAEVEQNGIFV
PPTLLEIDHISQIEHEVFGPVLHVIRFNADRFEQIIDDINSTGFGLTSGLHSRIDATIDQ
WLDKVHAGNLYVNRNTVGAVVGVQPFGGMGLSGTGPKAGGPLYLQRLVKSEAWTLADLEG
EAVIETDKLAQAVRQTLTGEQQSEALALLQTLRQKSPLAQVYKMQGITGENNYLRFEARP
MIAVSNGSLFAQIKALIAIAVCGSKAVVKKDSPLAEYAHQFAEYLMVTDDFNNLSALSVM
IVLEPLSTQERQHYAECNGSILTYVESLELALSLLPLVHEKSISINTAAAGGNATLMSEM
D
Download sequence
Identical sequences A3MYH8
gi|126207594|ref|YP_001052819.1| WP_011848319.1.77337 416269.APL_0106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]