SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126208173|ref|YP_001053398.1| from Actinobacillus pleuropneumoniae serovar 5b str. L20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126208173|ref|YP_001053398.1|
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 6.02e-53
Family Molybdopterin synthase subunit MoaE 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126208173|ref|YP_001053398.1|
Sequence length 151
Comment molybdopterin-converting factor subunit 2 [Actinobacillus pleuropneumoniae serovar 5b str. L20]
Sequence
MHTTLIEVQQETFDQNAIYRWLSEHHSVGATTLFVGKVREMNLGDNVSGLYLEHYPAMTK
KALQEIVDEARKRWGLQRVAVIHRIGQLHTGDEIVLVGVSSAHRGDAYHANEFIMDYLKT
RAPFWKRETTQDGDRWIEGRESDQLEADKWQ
Download sequence
Identical sequences A3N057
WP_009874716.1.47094 WP_009874716.1.77337 gi|126208173|ref|YP_001053398.1| 416269.APL_0693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]