SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126208330|ref|YP_001053555.1| from Actinobacillus pleuropneumoniae serovar 5b str. L20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126208330|ref|YP_001053555.1|
Domain Number 1 Region: 20-292
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.26e-91
Family Methylenetetrahydrofolate reductase 0.00000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126208330|ref|YP_001053555.1|
Sequence length 293
Comment 5,10-methylenetetrahydrofolate reductase [Actinobacillus pleuropneumoniae serovar 5b str. L20]
Sequence
MSYAKEIDHLNHTLADLNGNINASFEFFPAKNEKMEMLLWDSIHRLAPLKPKFVSVTYGA
NSGERKRTHSIVKRIQQDTGLAAAPHLTGIDANPEQLRIIAQDYWENGIRHIVALRGDEP
AGYAKKSFFAKDLVKLLKEVADFDISVAAYPEVHPEAKSAQSDLIYLKQKVEAGANRAIT
QFFFDIDSYLRFRDRCVTVGIDVEIVPGILPVTNFKQLQKMTKITNVKVPHWMHKMYEGL
DDDQTTRNLVAASIAMDMVKILSKEGVKDFHFYTLNHSELTYAICHALGVRPT
Download sequence
Identical sequences A3N0L4
WP_009874603.1.47094 WP_009874603.1.77337 416269.APL_0854 gi|126208330|ref|YP_001053555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]