SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126208386|ref|YP_001053611.1| from Actinobacillus pleuropneumoniae serovar 5b str. L20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126208386|ref|YP_001053611.1|
Domain Number 1 Region: 36-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.3e-75
Family Phosphate binding protein-like 0.00000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126208386|ref|YP_001053611.1|
Sequence length 273
Comment outer membrane lipoprotein 1 [Actinobacillus pleuropneumoniae serovar 5b str. L20]
Sequence
MNFKKVLGVALVSALALTGCNEEKKADAAAAQATSKIKVGVMSGPEHTVAEKAAQVAKQK
YGLEVEFVLFNDYALPNTAVSKGDLDANVFQHKPYLDKDSQSKGLTNLEIVGNTFVFPLA
GYSKKIKNVAELAEGAVVAVPNDPSNLARALILLEKQGLIKLKDNTNLFSTTLDIVENPK
KLNIKEVDTSVAAKALDDVDLAVVNNTYAGQVGLSANDGIFVEDKDSPYVNIIVARKDNK
DSEAVKNFVNAFQTEEVFGEAQKHFKDGVVKGW
Download sequence
Identical sequences A3N0S0
WP_009874634.1.47094 WP_009874634.1.77337 416269.APL_0910 gi|126208386|ref|YP_001053611.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]