SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126209158|ref|YP_001054383.1| from Actinobacillus pleuropneumoniae serovar 5b str. L20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126209158|ref|YP_001054383.1|
Domain Number 1 Region: 7-263
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.19e-61
Family Phosphate binding protein-like 0.000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126209158|ref|YP_001054383.1|
Sequence length 278
Comment antigenic protein, ABC transporter-like protein [Actinobacillus pleuropneumoniae serovar 5b str. L20]
Sequence
MKLSTTLKTLLATAITAFALTACDNANNAQSSTAKDSVAQIKEKGVIRIGVFGDKPPFGY
VDANGKSQGFDVEIAKEIANDLLGSSDKVEFVLTEAANRVEYLKSNKVDLILANFTKTPE
RAEVVDFAAPYMNVALGVVSPKGALISDLKQLEGKTLLVNKGTTADAYFTKNHPEINLLK
FDQNTETFDALKDGRGVALAHDNALVWAWAKENPTFDVAIGSVGPAEQIAPAVQKGNQAL
LDVINKEIAEFKTNGKLKAAYEKTLVPVYGDKPELLAQ
Download sequence
Identical sequences A3N2Z2 B3H2U0 E0FPX3
416269.APL_1694 537457.APP7_1755 gi|190151024|ref|YP_001969549.1| gi|126209158|ref|YP_001054383.1| WP_005618163.1.44215 WP_005618163.1.45850 WP_005618163.1.47094 WP_005618163.1.67471 WP_005618163.1.77337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]