SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152989987|ref|YP_001355709.1| from Nitratiruptor sp. SB155-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152989987|ref|YP_001355709.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.88e-36
Family Ribosomal protein L6 0.0000535
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.67e-20
Family Ribosomal protein L6 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152989987|ref|YP_001355709.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Nitratiruptor sp. SB155-2]
Sequence
MSRIGKQPVAIPSGVDVKIENGKIIAKKGNLTQEVEFGNRVNVSIEDNKIVFSPVGEDKQ
SKAFWGTYRALTNNAIEGLTKGFEKKLEINGVGYRAAVKGKELELQLGFSHPILYPIPEG
IQISVEKNIITIKGHDKQKVGQVAAEIRSFRPPEPYKGKGVKYVDEVIIRKAGKTAKK
Download sequence
Identical sequences A6Q1J3
WP_012081615.1.54627 387092.NIS_0238 gi|152989987|ref|YP_001355709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]