SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152991529|ref|YP_001357251.1| from Nitratiruptor sp. SB155-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152991529|ref|YP_001357251.1|
Domain Number 1 Region: 49-518
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 6.15e-81
Family Nitrous oxide reductase, N-terminal domain 0.00000106
Further Details:      
 
Domain Number 2 Region: 479-657
Classification Level Classification E-value
Superfamily Cupredoxins 2.44e-27
Family Nitrosocyanin 0.0012
Further Details:      
 
Domain Number 3 Region: 765-862
Classification Level Classification E-value
Superfamily Cytochrome c 8.09e-17
Family monodomain cytochrome c 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152991529|ref|YP_001357251.1|
Sequence length 867
Comment nitrous-oxide reductase NosZ [Nitratiruptor sp. SB155-2]
Sequence
MYRVMKRLISLVAAAGLVSTVSLAQGELEKIMKERGLTQDDILAAAKTYTPSGGRDKYIV
FSSGGQSGQIMVYGVPSMRILKFIGVFTPEPWQGWGYDDDTKKVLKEGWRNGKKITWGDT
HHPALSETNGVYDGKWLVINDKANPRLAVIDLKDFVTKQIVVNPVFKSDHGGAFFTPNSE
YILEACQYAAPFDNNYHPMEEYVDVYRGGVTVWKFDHENGRIIPDQSFTIEMPPYMQDLS
DAGKELSYGWGFTNSFNSEMYTGGIEKGLPPFEAGCSRNDTDYLHVYNWRKLAELAKDPK
NVKIINGHKVIPIEVAVKNDCLFLIPEPKSPHGVDVSPDGRYIVVCGKLDTHATVYDFKK
IMEAVKNHDFAGKDPYGIPIIDMKKAMHCQAELGLGPLHNQYGPKWKTEGEIYTSLYVDS
QVVKWDYLNCEIKDRVNVNYNIGHLCGMEGKTEDPQGEYIIALNKLAIDRFNPIGPLHPQ
NHQLIDVSGKKMKLLYDMPVPLGEPHQAVAIRASKLHPEVRYPMGTNPFTGKIHRGKTLA
GQEKIVRKGNHVYVYGTLVRSHINPEHVTVNKGDIVTFYLTNLERAEDETHGFTVDWYNV
HASLEPGKTVAVTFKADQEGVFPYYCTEFCSALHLEMMGYLLVKDPNKVYKSVRKIKLKK
MSKEELMKEYKKTVALNEATKKVIQSVVKFLKENHYEKYPVVKQLVEDALDQFNKVPAEE
KKAEEALKKGDIETAINFQYQAWQYLVKAADVGIRAKDLLVKKLATPMSEAAKRGEIAFA
EGGCNGCHVIGKVSSGPDLVGVLQRHENGEKWVAEFIKNPSKFYNDPYVKTLIDYFNLRM
PNQHMSDQQIKDIIEYLKWIDQNAHLF
Download sequence
Identical sequences A6Q5Y5
gi|152991529|ref|YP_001357251.1| WP_012083157.1.54627 387092.NIS_1789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]