SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116668922|ref|YP_829855.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116668922|ref|YP_829855.1|
Domain Number 1 Region: 200-319
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.62e-18
Family Glycosyl transferases group 1 0.047
Further Details:      
 
Weak hits

Sequence:  gi|116668922|ref|YP_829855.1|
Domain Number - Region: 67-122
Classification Level Classification E-value
Superfamily Formyltransferase 0.0733
Family Formyltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116668922|ref|YP_829855.1|
Sequence length 338
Comment transferase [Arthrobacter sp. FB24]
Sequence
MRILLWHVHGAWTDSFVRGPHEYLLPVLPGGGPWGLGRAGRNWPESVREVALESLDAGSI
DAVVLQRPEEIAEVGRALGRQPGKELPAVYLEHNTPRGNVPSTVHALADQHAIPLVHVTH
FNALFWDSGSAATTVIEHGVPDPGYLYTGEFPELAVVVNEPVRRGRVTGTDLLPRFAGAA
PLQVFGMGGDELPGHTGLPPSRLTVRGDLATAELHRELARCRVYVHPLRWTSLGLALLEA
MHLGLPVVVLATTEAARAVPPEAGAISTDVGELVRQARVLVSDPGEARARGLAARQAALE
RYSLGPFLDAWDALLDDLVSPRFRKSRILVPAHERKLP
Download sequence
Identical sequences A0JRT5
290399.Arth_0354 gi|116668922|ref|YP_829855.1| WP_011690225.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]