SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116669237|ref|YP_830170.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116669237|ref|YP_830170.1|
Domain Number 1 Region: 11-179
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.94e-33
Family Phosphoglucomutase, first 3 domains 0.00026
Further Details:      
 
Domain Number 2 Region: 167-274
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.1e-28
Family Phosphoglucomutase, first 3 domains 0.0001
Further Details:      
 
Domain Number 3 Region: 292-387
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.53e-26
Family Phosphoglucomutase, first 3 domains 0.00092
Further Details:      
 
Domain Number 4 Region: 390-474
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.35e-19
Family Phosphoglucomutase, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116669237|ref|YP_830170.1|
Sequence length 475
Comment phosphomannomutase [Arthrobacter sp. FB24]
Sequence
MERVTSDQTKTFDLSASFKAYDVRGIVGESITAEIVEAVGAAFVDVLKLEGQTVLVGGDM
RPSSPEFSKAFANGAATRGANVQLLDLISTDELYYACGALNAAGATFTASHNPAEYNGIK
MSKAGAQPISSESGLKDIQARAEEYLHAGSIPAAAKRGLIGVHDVLKDYSEYLRKLVDLR
GSRPLKVVVDAGNGMAGLTTPAVLGDALLPKLPFDIIPLYFELDGSFPNHPANPLEPENL
LDLQAAVVEHGADIGLAFDGDADRCFVIDEKGNPVSPSAITGMVARREIARAKAQGEETP
TIIHNLLTSRAVPELVAHDGGRAVRTRVGHSFIKAEMAEEGAVFGGEHSAHFYFRDFWNA
DTGMLAAMHVLAALGEQDLPLSELGHEYEPYVSSGEINSEIEDKAGAVERVRADFAGEDV
EIDTLDGSTFTARDGSWWFNLRPSNTEPFLRLNTEATDRATMERIRDRVLALVNG
Download sequence
Identical sequences A0JSQ0
gi|116669237|ref|YP_830170.1| 290399.Arth_0671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]