SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116669649|ref|YP_830582.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116669649|ref|YP_830582.1|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Formyltransferase 1.11e-62
Family Formyltransferase 0.00000934
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116669649|ref|YP_830582.1|
Sequence length 187
Comment phosphoribosylglycinamide formyltransferase [Arthrobacter sp. FB24]
Sequence
MRIVVLVSGTGSNLQAVIDAVKAGELDVEIAAVGADRPGTYGVERSAAAGIPTFVVDFKA
YADRAEWNAALTEAVAAYEPDVVVSSGFMRIVSPEFIDAFDGKYLNTHPALLPAFPGAHG
VRDAMAYGVKVTGCTVHWADAGVDTGPIIAQEAVAILDDDTEDTLHERIKVVERRLLVST
LAQLAAA
Download sequence
Identical sequences A0JTW2
gi|116669649|ref|YP_830582.1| 290399.Arth_1088 WP_011690949.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]