SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116670232|ref|YP_831165.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116670232|ref|YP_831165.1|
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Formyltransferase 1.22e-53
Family Formyltransferase 0.00000921
Further Details:      
 
Domain Number 2 Region: 205-295
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.51e-27
Family Post formyltransferase domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116670232|ref|YP_831165.1|
Sequence length 306
Comment methionyl-tRNA formyltransferase [Arthrobacter sp. FB24]
Sequence
MRVLFAGTPAVAVPSLDALVQAGFDVVAVLTRPDAPVGRKRVLTPSPVAARAAELGIEVI
HAAKVDAEVTARIAAAAPDAAAIVAYGGLIPRAALDVPRHGWINLHFSLLPAWRGAAPVQ
RAVMAGDDITGAVTFLLEEGLDTGPVFGTLTESVRPDDTSGELLERLSHSGAALLAQTLS
AIEAGRAVAVPQSGDVSLAPKLGIDDGRIDWHEPALAIGRRARGVTPEPGAWTTLDGQRV
KLEPVALRTDAPALQPGQVLLDGKSVLVGTGSHPVELTRIQPSGKKMMAAADWARGQVAL
EGVVFE
Download sequence
Identical sequences A0JVJ5
290399.Arth_1671 gi|116670232|ref|YP_831165.1| WP_011691531.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]