SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116672169|ref|YP_833102.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116672169|ref|YP_833102.1|
Domain Number 1 Region: 19-408
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.35e-98
Family Homocysteine S-methyltransferase 0.00000931
Further Details:      
 
Domain Number 2 Region: 918-1216
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.88e-86
Family Methionine synthase SAM-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 366-632
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 4.32e-75
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00017
Further Details:      
 
Domain Number 4 Region: 753-889
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 3.53e-36
Family Cobalamin (vitamin B12)-binding domain 0.00011
Further Details:      
 
Domain Number 5 Region: 670-752
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.31e-24
Family Methionine synthase domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116672169|ref|YP_833102.1|
Sequence length 1216
Comment methionine synthase [Arthrobacter sp. FB24]
Sequence
MPRFALDIESVPRPVRAQELLDAVNTRVVIADGAMGTMLQGRELSLEKDFLGLEGCNEIL
NDTRPDVLADIHDAYFATGIDAVETNTFGANWSNLSDYGIDDRIEELARKGAAIARERAE
AAEKTDGRMRWVLGSMGPGTKLPSLGHTTYDYLKQTFALQAEGLIDGGADAFLIETSQDL
LQTKAAVNGCKQAIVTRGIRLPIFVEVTVETTGTMLMGSEIGAALTALEPLGVDAIGLNC
ATGPDEMSEHLRHLSKQSSVAIACMPNAGLPVLGPNGAHYPLSPSELATAHEQFVREFGL
GLVGGCCGTTPEHMAAVVERLAPLRASAAVTSGGRGADGSRVPTEREAGIASLYHHVPFD
QESAYLAIGERTNANGSKAFRQAMLEERWDDCVDIAREQVRVGAHLLDVCIDYVGRDGVA
DIKEIVSRFASASTLPLVIDSTEPPVLQAGLELIGGRPVVNSVNYEDGDGPNSRFARIMP
LVKEHGTAVIALTIDEQGQARTTEGKVAIASRLVDALVGEWGMRVEDIIVDALTFPVATG
QEETRRDGIETIEAIRQITTKYPGINTTLGVSNVSFGLNPAARVVLNSVFLHEAVQAGLS
SGIIDAAKIVPLASLPEEQRKVALDLVYDRREYDADGNVTYDPLAIMLDLFAGVDTAALK
DQRAAELAALPTGERLQRRIIDGEGKGLEADLDLARSEGMTPLGIINDQLLEGMKVVGER
FGAGEMQLPFVLQSAEVMKNAVALLEPHMEKSDSSGKGTMVIATVRGDVHDIGKNLVDII
LTNNGYKVVNIGIKQGIAEIMAAAEEHNADVIGMSGLLVKSTVVMKENLAELQSRGLAKK
WPIILGGAALTRAYVEQDLAEQFEGTVRYAKDAFEGLALMEPLVQVARGADPDAVGLPPL
KKRIHKGGPKFTVTEPEAMPGRSDVASDNLVPSPPFWGTRIVRGVALHDYAALLDERATF
MGQWGLKPGRGDDGASYEELVELEGRPRLRYWLDRILAEGMLDASVAYGYFPVVSEGEQV
VVLHHGEDHDGVLGTPGLLAPDGGSGGPIGTERLRFDFPRQRRDRHLCLADFVRSRESGQ
VDVLPVQLVTAGSKIDEVTSELFKGNHYRDYYELNGLVMQLTEALAEFWHARIRSELGFA
AEEPKDKAGYFKLDYRGARFSLGYPACPDMEDRRKVTELLKPERMGVVLSDELMLHPEQS
TDAFVFHHPEAKYFKV
Download sequence
Identical sequences A0K132
WP_011693452.1.37281 290399.Arth_3627 gi|116672169|ref|YP_833102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]