SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116671189|ref|YP_832122.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116671189|ref|YP_832122.1|
Domain Number 1 Region: 207-346
Classification Level Classification E-value
Superfamily CBS-domain pair 5.56e-26
Family CBS-domain pair 0.0038
Further Details:      
 
Domain Number 2 Region: 352-432
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000158
Family CorC/HlyC domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116671189|ref|YP_832122.1|
Sequence length 445
Comment hypothetical protein Arth_2643 [Arthrobacter sp. FB24]
Sequence
MEWLLLGAGILLILGTGFFVAVEFSLVALDQATVQRAVDSGDAAAVPLLKCLKSLSTQLS
SCQLGITLTTLLTGYVMEPSVGKLLEGPLTAAGVPEAAAASVSLVMAMTIATLLSMLIGE
LVPKNMAIALSLPIGKAVARPQLVFTAVFKPAIIVLNGFSNKVLNVFGLEAKEEISGART
PAELASLVRRSAAMGTLDPGTANFIARTLKFSGRTAADVMTPRIRLETIGAAQPVSDIID
AARRTGYSRFPVIGESADDIRGLVHVKKAIAVPSERRANLEAGAIMTDVLRVPETIHLDA
LLAELREGNMQLAVVLDEYGGTAGIATLEDLVEEIVGEVADEHDKVRPGLLQSASGDWYF
PGLLRPDELSEQIPGLTVPDESAYETVGGYVMSQLGRIAAVGDTVDVGGGTLSVTRMDGR
RIDRICFKPAPVLGEEHAAGQGGTA
Download sequence
Identical sequences A0JYA2
290399.Arth_2643 WP_011692484.1.37281 gi|116671189|ref|YP_832122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]