SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116671526|ref|YP_832459.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116671526|ref|YP_832459.1|
Domain Number 1 Region: 17-297
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.78e-109
Family G proteins 0.0000000203
Further Details:      
 
Domain Number 2 Region: 495-618
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-41
Family Translational machinery components 0.0000236
Further Details:      
 
Domain Number 3 Region: 280-420
Classification Level Classification E-value
Superfamily Translation proteins 7.83e-33
Family Elongation factors 0.00014
Further Details:      
 
Domain Number 4 Region: 622-709
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.8e-29
Family EF-G/eEF-2 domains III and V 0.00015
Further Details:      
 
Domain Number 5 Region: 420-497
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.55e-24
Family EF-G/eEF-2 domains III and V 0.0000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116671526|ref|YP_832459.1|
Sequence length 713
Comment elongation factor G [Arthrobacter sp. FB24]
Sequence
MQSIRKGDTVAQDVLTDLSKVRNIGIMAHIDAGKTTTTERILFYTGVNHKIGETHDGAST
TDWMEQEKERGITITSAAVTCFWENNQINIIDTPGHVDFTVEVERSLRVLDGAVAVFDGK
EGVEPQSETVWRQADKYNVPRICFVNKMDKLGADFYFTVDTIISRLGAKPLVMQLPIGAE
NDFIGVVDLLYMRALVWPGDSKGDVTMGAKYEIQEIPADLKEKAEEYRATLIETVAEASE
ELMEKYLEGEEISVDELKAGIRKMTINSEIYPVFCGSAFKNRGVQPMLDAVVDYLPNPLD
VPPMIGHDPRDEEKELTRKPSSEEPFSALAFKIAAHPFFGQLTFIRVYSGHVEAGAQVVN
STKGKKERIGKLFQMHANKEMPVEGATAGHIYAAIGLKDTTTGDTLCDSANQIVLESMSF
PEPVISVAIEPNTKGDQEKLSTAIQKLSAEDPTFQVSLNEDTGQTIIAGMGELHLDILVD
RMRREFKVEANVGKPQVAYRETIKRAVERHDYTHKKQTGGSGQFAKIQIAIAPLDTSDGE
LYEFENKVTGGRIPREYIPSVDAGIQDALNDGVLAGYPVVGIKATLIDGAYHDVDSSEMA
FKIAGRMAFKEAARKANPILLEPLMDVEVRTPEEYMGEVIGDLNSRRGQMQSMEDAQGVK
VIRAHVPLSGMFGYIGDLRSKTQGRAVYSMTFHSYAEVPKAFADEIIQKNRGE
Download sequence
Identical sequences A0JZ89
290399.Arth_2980 gi|116671526|ref|YP_832459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]