SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116672204|ref|YP_833137.1| from Arthrobacter sp. FB24

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116672204|ref|YP_833137.1|
Domain Number 1 Region: 207-346
Classification Level Classification E-value
Superfamily CBS-domain pair 6.19e-29
Family CBS-domain pair 0.0031
Further Details:      
 
Domain Number 2 Region: 358-436
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.34e-16
Family CorC/HlyC domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116672204|ref|YP_833137.1|
Sequence length 453
Comment hypothetical protein Arth_3662 [Arthrobacter sp. FB24]
Sequence
MYEWIMLGIGLVLTVGTGFFVASEFALVNLDRNDLEARQARGEKRLAPTIKALKITSTHL
SGAQLGITLTTLLTGYTFEPAISKMLSGPLLAAGLPESVVPGIGAVAGIFLATIFSMVIG
ELVPKNFALALPLATAKIVVPFQALFTAVFKPVILLFNNTANGIIRSFGIEPKEELSGAR
SAEELSSLVRRSALEGVLDVDHAVLLHRTLRFSEHSAADVMTPRVRMTAVNADDTAEQIV
TLATSTGYSRFPVIGRDRDDVLGVLHVKQAFAVALEERANVTAASLMIDPLRVPESMGVD
TLLVLLRRQGLQVAIVSDEHGGTAGIVTLEDLVEEIVGELEDEHDRARVGVVRIGRAITF
DASLRPDELLDRTGIEVPDGEEYDTIAGFVTDQLDRIPELGDEVTVDGGTLRVERVVGTH
VERLRFTPDESQEAPQSPHDRIIDTLTSELTHE
Download sequence
Identical sequences A0K167
gi|116672204|ref|YP_833137.1| 290399.Arth_3662 WP_011693487.1.37281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]