SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123440784|ref|YP_001004776.1| from Yersinia enterocolitica subsp. enterocolitica 8081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123440784|ref|YP_001004776.1|
Domain Number 1 Region: 344-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3e-22
Family CorC/HlyC domain-like 0.0000396
Further Details:      
 
Domain Number 2 Region: 200-335
Classification Level Classification E-value
Superfamily CBS-domain pair 1.08e-20
Family CBS-domain pair 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123440784|ref|YP_001004776.1|
Sequence length 443
Comment hypothetical protein YE0403 [Yersinia enterocolitica subsp. enterocolitica 8081]
Sequence
MLNSILLILFLIAVSAFFSLSEISLAASRKIKLKLLADEGDINALRVLKLQETPGIFFTV
VQIGLNAVAILGGIVGDAAFSPSFKVVFERFMSPELADQVSFICSFVLVTSLFILFADLT
PKRIGMISPEAVAVRIVNPMRFCIMICRPLVWFFNGMANLIFRLFKLPMVRNDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRESVIYFDLRESEDSIKEKIST
HPHSKFLVCDGHIDQVVGYVDSKDLLNRVLGNQSLVLSSGVQIRSALIVPDTLTLSEALE
SFKTAGEDFAVILNEYALVVGIITLNDVMTTLMGDLVGQGQEEQIVARDENSWLIEGGTP
IEDVMRVLHIDEFPQSGNYETIGGFMMYMLRKIPKRTDFVKYAGYKFEVVDIDSYKIDQL
LVTRFSDQPTPILPKAPHESSDA
Download sequence
Identical sequences A1JIT9
gi|123440784|ref|YP_001004776.1| WP_011815438.1.51324 WP_011815438.1.91311 YP_001004776.1.77335 393305.YE0403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]