SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123442994|ref|YP_001006969.1| from Yersinia enterocolitica subsp. enterocolitica 8081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123442994|ref|YP_001006969.1|
Domain Number 1 Region: 292-426
Classification Level Classification E-value
Superfamily CBS-domain pair 9.47e-25
Family CBS-domain pair 0.0039
Further Details:      
 
Domain Number 2 Region: 439-523
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.15e-21
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123442994|ref|YP_001006969.1|
Sequence length 528
Comment hypothetical protein YE2779 [Yersinia enterocolitica subsp. enterocolitica 8081]
Sequence
MEWIADPTIWAGLATLVVLEIVLGIDNLIFIAILAEKLPRHLRDKARVTGLLCALVMRLV
LLASISWLATLTAPLVTISNHPFSARDLIMLIGGVFLLFKATMELNERLEGKDHQQNQQR
KGARFWPVVAQIVVLDAIFSLDSVITAVGMVDHLAVMMAAVCIAIGLMLLASKSLTRFVN
AHPTIVILCLSFLLMIGFSLVAEGFGYHIPKGYLYAAIGFSVIIESLNQFAQFNRRRFLS
TVRPLRERTAEAVLRMLSGKHEEAELDNHTANLIADNTSVGQEVFNEQERRMIERVLGLA
QRTVSSIMTSRHDVEYLDLNDPPEKLTQLLTKNLHTRIVVTEDSSTDEPLGVIHVIDLLK
QQLANEKLDLRALIRQPLIFPEQVSLLMALEQFRQAQTHFAFVVDEFGSIEGVVTLTDVM
ETIAGNLPVAGEELDARHDIQQTDDGCWVANGYMPLEDLVLYLPLPIDDKREYHTLAGLL
MEYTQRIPKVGEQLKIGDYLFEPIEVSSHRILKVKITPLKVPDPDYEV
Download sequence
Identical sequences A0A0T9SRZ0 A1JTX0
gi|123442994|ref|YP_001006969.1| 393305.YE2779 WP_005168322.1.100034 WP_005168322.1.28488 WP_005168322.1.29173 WP_005168322.1.39120 WP_005168322.1.39701 WP_005168322.1.51324 WP_005168322.1.53745 WP_005168322.1.62658 WP_005168322.1.69335 WP_005168322.1.7032 WP_005168322.1.75090 WP_005168322.1.78943 WP_005168322.1.80986 WP_005168322.1.85569 WP_005168322.1.91311 WP_005168322.1.95393 WP_005168322.1.98085 YP_001006969.1.77335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]