SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123443203|ref|YP_001007177.1| from Yersinia enterocolitica subsp. enterocolitica 8081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123443203|ref|YP_001007177.1|
Domain Number 1 Region: 66-202
Classification Level Classification E-value
Superfamily CBS-domain pair 3.16e-32
Family CBS-domain pair 0.0021
Further Details:      
 
Domain Number 2 Region: 203-289
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.54e-24
Family CorC/HlyC domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123443203|ref|YP_001007177.1|
Sequence length 292
Comment hypothetical protein YE2988 [Yersinia enterocolitica subsp. enterocolitica 8081]
Sequence
MSDDHSQNNDSPSPKKGFFTLILNQLFHGEPKNRGDLVELIRDSEQNDLIDPDTRDMLEG
VMDIAEQRVRDIMIPRSQMVTLKRNQTLDECLDVIIESAHSRFPVISEDKDHIEGILMAK
DLLPFMRTDSEPFSIDKVLRTAVVVPESKRVDRMLKEFRSQRYHMAIVIDEFGGVSGLVT
IEDILELIVGEIEDEYDDEEDRDVRQLSRHTYTIRALTPIEDFNEVFNTHFSDDEVDTIG
GLVMQAFGHLPARGETIEIEGYLFKVAMADSRRIIQVHVKIPDDAPQPKLEE
Download sequence
Identical sequences A0A0B6FIC7 A0A0E1NKM2 A0A0H3NPE9 A0A0T9NC62 A1JQ75
393305.YE2988 gi|386309352|ref|YP_006005408.1| WP_005158416.1.100034 WP_005158416.1.102102 WP_005158416.1.111 WP_005158416.1.11347 WP_005158416.1.12212 WP_005158416.1.13969 WP_005158416.1.13971 WP_005158416.1.14274 WP_005158416.1.15520 WP_005158416.1.16 WP_005158416.1.16413 WP_005158416.1.16548 WP_005158416.1.16723 WP_005158416.1.17047 WP_005158416.1.17975 WP_005158416.1.18790 WP_005158416.1.18893 WP_005158416.1.19087 WP_005158416.1.20762 WP_005158416.1.22054 WP_005158416.1.23689 WP_005158416.1.23750 WP_005158416.1.24393 WP_005158416.1.24455 WP_005158416.1.2482 WP_005158416.1.25150 WP_005158416.1.26415 WP_005158416.1.26676 WP_005158416.1.2681 WP_005158416.1.27215 WP_005158416.1.27291 WP_005158416.1.2756 WP_005158416.1.27645 WP_005158416.1.27663 WP_005158416.1.27954 WP_005158416.1.27965 WP_005158416.1.28488 WP_005158416.1.29173 WP_005158416.1.29200 WP_005158416.1.32200 WP_005158416.1.32298 WP_005158416.1.33645 WP_005158416.1.33697 WP_005158416.1.33842 WP_005158416.1.34535 WP_005158416.1.34811 WP_005158416.1.36310 WP_005158416.1.36845 WP_005158416.1.37307 WP_005158416.1.37339 WP_005158416.1.37377 WP_005158416.1.3739 WP_005158416.1.37392 WP_005158416.1.38467 WP_005158416.1.39120 WP_005158416.1.39701 WP_005158416.1.39843 WP_005158416.1.41617 WP_005158416.1.42927 WP_005158416.1.45624 WP_005158416.1.4568 WP_005158416.1.46310 WP_005158416.1.46877 WP_005158416.1.47289 WP_005158416.1.49096 WP_005158416.1.49172 WP_005158416.1.49903 WP_005158416.1.50284 WP_005158416.1.50873 WP_005158416.1.50913 WP_005158416.1.51324 WP_005158416.1.51802 WP_005158416.1.52128 WP_005158416.1.52282 WP_005158416.1.52510 WP_005158416.1.52530 WP_005158416.1.53745 WP_005158416.1.54645 WP_005158416.1.54893 WP_005158416.1.56946 WP_005158416.1.57177 WP_005158416.1.57251 WP_005158416.1.59297 WP_005158416.1.59314 WP_005158416.1.59817 WP_005158416.1.60054 WP_005158416.1.60229 WP_005158416.1.6227 WP_005158416.1.62658 WP_005158416.1.6276 WP_005158416.1.63044 WP_005158416.1.64141 WP_005158416.1.64144 WP_005158416.1.64607 WP_005158416.1.64724 WP_005158416.1.64872 WP_005158416.1.65310 WP_005158416.1.6623 WP_005158416.1.67007 WP_005158416.1.67544 WP_005158416.1.67688 WP_005158416.1.68551 WP_005158416.1.69335 WP_005158416.1.70167 WP_005158416.1.7028 WP_005158416.1.7032 WP_005158416.1.70348 WP_005158416.1.70521 WP_005158416.1.72301 WP_005158416.1.72703 WP_005158416.1.72721 WP_005158416.1.73937 WP_005158416.1.73944 WP_005158416.1.74370 WP_005158416.1.75090 WP_005158416.1.75238 WP_005158416.1.75560 WP_005158416.1.75717 WP_005158416.1.75818 WP_005158416.1.76565 WP_005158416.1.77079 WP_005158416.1.77263 WP_005158416.1.78074 WP_005158416.1.78907 WP_005158416.1.78943 WP_005158416.1.78961 WP_005158416.1.78974 WP_005158416.1.79061 WP_005158416.1.79150 WP_005158416.1.79299 WP_005158416.1.79375 WP_005158416.1.80565 WP_005158416.1.80986 WP_005158416.1.81839 WP_005158416.1.8184 WP_005158416.1.81865 WP_005158416.1.82708 WP_005158416.1.82975 WP_005158416.1.83529 WP_005158416.1.84522 WP_005158416.1.84626 WP_005158416.1.8474 WP_005158416.1.85518 WP_005158416.1.85569 WP_005158416.1.85902 WP_005158416.1.86289 WP_005158416.1.86434 WP_005158416.1.87836 WP_005158416.1.88911 WP_005158416.1.91014 WP_005158416.1.91311 WP_005158416.1.91362 WP_005158416.1.91446 WP_005158416.1.92887 WP_005158416.1.93960 WP_005158416.1.94591 WP_005158416.1.94794 WP_005158416.1.94848 WP_005158416.1.95393 WP_005158416.1.95930 WP_005158416.1.96208 WP_005158416.1.9637 WP_005158416.1.96818 WP_005158416.1.97603 WP_005158416.1.98085 WP_005158416.1.99238 YP_001007177.1.77335 gi|123443203|ref|YP_001007177.1| gi|332160871|ref|YP_004297448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]