SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145596018|ref|YP_001160315.1| from Salinispora tropica CNB-440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145596018|ref|YP_001160315.1|
Domain Number 1 Region: 5-110
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.55e-24
Family DNA-binding N-terminal domain of transcription activators 0.0017
Further Details:      
 
Domain Number 2 Region: 119-271
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 9.68e-20
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145596018|ref|YP_001160315.1|
Sequence length 274
Comment transcription activator, effector binding [Salinispora tropica CNB-440]
Sequence
MDDLIPIGRFSRMSRLSVKALRFYDKQGLLAPAWVDPSSGYRYYRRAQAGRAEAIRVLRA
IDMPVGDIRDLLADDDPELTGKRLVAHRERLRARLAEQERMLRFLEELIDRGGHVMPYDV
IVKEVETVPVASLTLHTSLDAIGADMGRGFGTVVDAIGNAGTEANGKPFVVYHDVIDEQT
TGDIEICIPVPAGTVLPSGPVRYRELRGGPIASTVHRGPYQEISPAYHVVTGWIEQEGVH
PAGPPREVYLNDPQTVSPAELLTEVQFPIDKASH
Download sequence
Identical sequences A4XAI8
WP_012014712.1.12452 WP_012014712.1.28039 WP_012014712.1.3277 WP_012014712.1.3377 WP_012014712.1.34286 WP_012014712.1.43425 WP_012014712.1.57249 WP_012014712.1.65288 WP_012014712.1.69032 WP_012014712.1.88928 WP_012014712.1.9676 369723.Strop_3506 gi|145596018|ref|YP_001160315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]