SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145593674|ref|YP_001157971.1| from Salinispora tropica CNB-440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145593674|ref|YP_001157971.1|
Domain Number 1 Region: 91-186
Classification Level Classification E-value
Superfamily E set domains 5.11e-21
Family Copper resistance protein C (CopC, PcoC) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145593674|ref|YP_001157971.1|
Sequence length 607
Comment copper resistance protein CopC [Salinispora tropica CNB-440]
Sequence
MVVGTFAPRWALPRRELSRGEVRLPTYELGGAARSWVSRRPKSGWASGAFWASMTGMSVV
LRRWTARLTAVGGLLIALVALLVAPAGPASAHAVLVSSSPASSAVVPDAPTEVVLTFSES
VRKVPGKTRVIAPDGSRADRGEPSFEGAVVVIPVDPNSGRGTYLVSFRVISADSHPVSGA
FTYSVGAPSTPPVDTGSDSRADPVVSVGIKIGKYLGYAGLLLLVGPVLVLALLWPRRLSR
RGPARLAWTGLGLLAFATLATGWLQVPYTNGGGVFDLTGAGVSTVLGSPFGAAHLVRLGL
LAAAAFVLRPLLAGPVGRTDLVILGVLGGGALLTWPLSGHPAVSPAPVVSVVVDAVHLGG
MAVWLGGLVMLAGFLLRQADEGELSAILPIWSRWAALSVSVLLVAGVVQALIEVASFAAL
VDTPYGRLLLGKVGLFALVVAVAAYSRALVRRGAAAERPAPVRRAILVELAITAVLLGLA
AALVQTTPARTAVADTAQSGSDYFSTTLTSSLYSLQVEVDPARRGNNSVHFYAYTPDNRP
QPVAEWRATVALPGAGIEPIEVPLLPLTDNHATGEINLPASGDWQLRVTVRTSEIDQATV
ATTVAVS
Download sequence
Identical sequences A4X3Z3
369723.Strop_1122 gi|145593674|ref|YP_001157971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]