SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150392889|ref|YP_001315564.1| from Staphylococcus aureus subsp. aureus JH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150392889|ref|YP_001315564.1|
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.62e-95
Family Homocysteine S-methyltransferase 0.00000415
Further Details:      
 
Domain Number 2 Region: 318-601
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.1e-66
Family Methylenetetrahydrofolate reductase 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150392889|ref|YP_001315564.1|
Sequence length 613
Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase [Staphylococcus aureus subsp. aureus JH1]
Sequence
MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVERIHRSYIEAGADVIQT
NTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTVGGFRGIKQEDISLQTI
LYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDIPIIAQLTASNTNYLVNG
QAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHAFLSCYPNASLLDIENSEF
KYSDNAQYFGQVAQNLIREGVRLIGGCCGTTPEHIKFIKESIQTLKPVNDKKVIPIPTKA
LFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFENIAKLDKANVDAVTLADNSL
ATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSHLLGLSLIGVNEILAITGDPSK
VGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKKRTHFNIAGAFNPNVRKLDGAVK
RLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKPFFIGIMPIASYKNALFLHNEVPG
IKMSDEILQQFEAVKDDKAKTRELSLKLSKDLIDTVHEYFNGLYIITPFQNVEDSLELAA
YSKSITAHKEAIL
Download sequence
Identical sequences A0A0E1VLA5 A0A0H3JSU6 A0A0H3JXC9 A0A1Q8R3H4 T1Y6G2
gi|150392889|ref|YP_001315564.1| gi|15923347|ref|NP_370881.1| 158878.SAV0357 158879.SA0345 359786.SaurJH9_0405 359787.SaurJH1_0415 418127.SAHV_0354 681288.SAAV_0325 gi|15926058|ref|NP_373591.1| WP_000077317.1.10006 WP_000077317.1.10014 WP_000077317.1.100171 WP_000077317.1.100184 WP_000077317.1.100235 WP_000077317.1.10032 WP_000077317.1.100335 WP_000077317.1.100357 WP_000077317.1.100366 WP_000077317.1.100399 WP_000077317.1.10046 WP_000077317.1.100464 WP_000077317.1.10050 WP_000077317.1.100535 WP_000077317.1.100562 WP_000077317.1.100582 WP_000077317.1.100596 WP_000077317.1.100612 WP_000077317.1.100693 WP_000077317.1.100699 WP_000077317.1.100704 WP_000077317.1.100719 WP_000077317.1.100823 WP_000077317.1.100832 WP_000077317.1.100860 WP_000077317.1.100888 WP_000077317.1.100934 WP_000077317.1.10097 WP_000077317.1.101002 WP_000077317.1.101019 WP_000077317.1.101027 WP_000077317.1.101058 WP_000077317.1.101068 WP_000077317.1.101071 WP_000077317.1.101072 WP_000077317.1.101103 WP_000077317.1.10111 WP_000077317.1.101160 WP_000077317.1.101192 WP_000077317.1.101262 WP_000077317.1.101329 WP_000077317.1.101379 WP_000077317.1.101414 WP_000077317.1.101440 WP_000077317.1.101441 WP_000077317.1.10148 WP_000077317.1.101511 WP_000077317.1.101567 WP_000077317.1.10165 WP_000077317.1.101661 WP_000077317.1.101691 WP_000077317.1.101704 WP_000077317.1.101728 WP_000077317.1.101745 WP_000077317.1.101778 WP_000077317.1.101813 WP_000077317.1.101820 WP_000077317.1.101825 WP_000077317.1.101852 WP_000077317.1.101902 WP_000077317.1.101906 WP_000077317.1.101922 WP_000077317.1.101943 WP_000077317.1.102065 WP_000077317.1.102096 WP_000077317.1.102123 WP_000077317.1.102130 WP_000077317.1.102132 WP_000077317.1.10238 WP_000077317.1.1025 WP_000077317.1.10274 WP_000077317.1.1031 WP_000077317.1.10343 WP_000077317.1.10355 WP_000077317.1.1043 WP_000077317.1.10436 WP_000077317.1.10478 WP_000077317.1.10481 WP_000077317.1.1052 WP_000077317.1.10526 WP_000077317.1.10624 WP_000077317.1.10749 WP_000077317.1.10751 WP_000077317.1.1077 WP_000077317.1.10823 WP_000077317.1.10858 WP_000077317.1.1087 WP_000077317.1.10919 WP_000077317.1.10942 WP_000077317.1.10976 WP_000077317.1.10979 WP_000077317.1.10985 WP_000077317.1.11001 WP_000077317.1.11069 WP_000077317.1.11073 WP_000077317.1.11083 WP_000077317.1.11084 WP_000077317.1.1115 WP_000077317.1.11162 WP_000077317.1.11220 WP_000077317.1.11261 WP_000077317.1.11282 WP_000077317.1.11286 WP_000077317.1.11322 WP_000077317.1.11333 WP_000077317.1.11378 WP_000077317.1.11403 WP_000077317.1.11447 WP_000077317.1.11451 WP_000077317.1.1147 WP_000077317.1.11504 WP_000077317.1.11513 WP_000077317.1.11556 WP_000077317.1.11611 WP_000077317.1.11640 WP_000077317.1.11646 WP_000077317.1.11655 WP_000077317.1.11663 WP_000077317.1.1171 WP_000077317.1.11730 WP_000077317.1.11736 WP_000077317.1.11768 WP_000077317.1.11794 WP_000077317.1.11837 WP_000077317.1.11884 WP_000077317.1.11903 WP_000077317.1.12019 WP_000077317.1.12042 WP_000077317.1.1210 WP_000077317.1.12149 WP_000077317.1.12152 WP_000077317.1.12170 WP_000077317.1.12175 WP_000077317.1.12234 WP_000077317.1.12256 WP_000077317.1.12330 WP_000077317.1.12361 WP_000077317.1.12366 WP_000077317.1.12391 WP_000077317.1.12436 WP_000077317.1.12437 WP_000077317.1.12508 WP_000077317.1.1257 WP_000077317.1.12598 WP_000077317.1.12608 WP_000077317.1.12618 WP_000077317.1.12685 WP_000077317.1.12733 WP_000077317.1.12737 WP_000077317.1.12770 WP_000077317.1.12780 WP_000077317.1.12788 WP_000077317.1.12829 WP_000077317.1.12858 WP_000077317.1.12884 WP_000077317.1.12904 WP_000077317.1.12920 WP_000077317.1.13013 WP_000077317.1.13062 WP_000077317.1.13154 WP_000077317.1.13169 WP_000077317.1.13189 WP_000077317.1.13243 WP_000077317.1.13250 WP_000077317.1.13326 WP_000077317.1.13355 WP_000077317.1.13379 WP_000077317.1.13405 WP_000077317.1.13448 WP_000077317.1.13514 WP_000077317.1.13554 WP_000077317.1.13612 WP_000077317.1.13650 WP_000077317.1.13665 WP_000077317.1.13668 WP_000077317.1.13670 WP_000077317.1.13879 WP_000077317.1.13897 WP_000077317.1.13933 WP_000077317.1.13986 WP_000077317.1.13987 WP_000077317.1.14025 WP_000077317.1.14097 WP_000077317.1.14163 WP_000077317.1.1420 WP_000077317.1.14201 WP_000077317.1.1425 WP_000077317.1.1429 WP_000077317.1.14305 WP_000077317.1.14342 WP_000077317.1.14358 WP_000077317.1.14397 WP_000077317.1.14412 WP_000077317.1.14535 WP_000077317.1.14577 WP_000077317.1.14590 WP_000077317.1.14596 WP_000077317.1.14639 WP_000077317.1.14696 WP_000077317.1.1471 WP_000077317.1.14729 WP_000077317.1.14734 WP_000077317.1.14774 WP_000077317.1.14825 WP_000077317.1.14846 WP_000077317.1.14924 WP_000077317.1.14967 WP_000077317.1.14970 WP_000077317.1.15015 WP_000077317.1.15029 WP_000077317.1.15108 WP_000077317.1.15173 WP_000077317.1.15185 WP_000077317.1.1520 WP_000077317.1.15201 WP_000077317.1.1525 WP_000077317.1.15268 WP_000077317.1.15269 WP_000077317.1.15294 WP_000077317.1.15296 WP_000077317.1.15421 WP_000077317.1.15478 WP_000077317.1.15507 WP_000077317.1.15533 WP_000077317.1.15544 WP_000077317.1.15546 WP_000077317.1.1558 WP_000077317.1.15590 WP_000077317.1.1564 WP_000077317.1.1569 WP_000077317.1.15691 WP_000077317.1.15722 WP_000077317.1.15785 WP_000077317.1.15812 WP_000077317.1.159 WP_000077317.1.15920 WP_000077317.1.15921 WP_000077317.1.15925 WP_000077317.1.16018 WP_000077317.1.16068 WP_000077317.1.16096 WP_000077317.1.16098 WP_000077317.1.16140 WP_000077317.1.16173 WP_000077317.1.16195 WP_000077317.1.16203 WP_000077317.1.16223 WP_000077317.1.1623 WP_000077317.1.16251 WP_000077317.1.16265 WP_000077317.1.16276 WP_000077317.1.16311 WP_000077317.1.16395 WP_000077317.1.16407 WP_000077317.1.16458 WP_000077317.1.16589 WP_000077317.1.16632 WP_000077317.1.16639 WP_000077317.1.1665 WP_000077317.1.16651 WP_000077317.1.16653 WP_000077317.1.16693 WP_000077317.1.16747 WP_000077317.1.16761 WP_000077317.1.16794 WP_000077317.1.16815 WP_000077317.1.16880 WP_000077317.1.16882 WP_000077317.1.16920 WP_000077317.1.16925 WP_000077317.1.16969 WP_000077317.1.170 WP_000077317.1.17012 WP_000077317.1.17046 WP_000077317.1.17080 WP_000077317.1.17122 WP_000077317.1.17132 WP_000077317.1.17139 WP_000077317.1.17157 WP_000077317.1.17180 WP_000077317.1.17240 WP_000077317.1.1725 WP_000077317.1.1729 WP_000077317.1.17309 WP_000077317.1.17327 WP_000077317.1.1736 WP_000077317.1.1741 WP_000077317.1.17419 WP_000077317.1.17454 WP_000077317.1.17529 WP_000077317.1.17531 WP_000077317.1.1756 WP_000077317.1.17590 WP_000077317.1.17643 WP_000077317.1.1765 WP_000077317.1.17671 WP_000077317.1.17717 WP_000077317.1.17718 WP_000077317.1.17729 WP_000077317.1.17737 WP_000077317.1.17796 WP_000077317.1.17818 WP_000077317.1.17832 WP_000077317.1.17847 WP_000077317.1.17853 WP_000077317.1.17909 WP_000077317.1.17922 WP_000077317.1.17943 WP_000077317.1.17987 WP_000077317.1.18011 WP_000077317.1.18069 WP_000077317.1.18080 WP_000077317.1.18113 WP_000077317.1.18140 WP_000077317.1.18153 WP_000077317.1.18203 WP_000077317.1.18237 WP_000077317.1.18248 WP_000077317.1.18261 WP_000077317.1.18288 WP_000077317.1.1829 WP_000077317.1.18301 WP_000077317.1.18309 WP_000077317.1.18310 WP_000077317.1.18346 WP_000077317.1.18360 WP_000077317.1.18412 WP_000077317.1.18429 WP_000077317.1.1847 WP_000077317.1.18487 WP_000077317.1.18506 WP_000077317.1.18507 WP_000077317.1.18539 WP_000077317.1.18560 WP_000077317.1.18591 WP_000077317.1.18632 WP_000077317.1.18679 WP_000077317.1.18741 WP_000077317.1.18777 WP_000077317.1.18792 WP_000077317.1.18818 WP_000077317.1.18819 WP_000077317.1.18834 WP_000077317.1.18882 WP_000077317.1.1892 WP_000077317.1.18965 WP_000077317.1.18974 WP_000077317.1.19052 WP_000077317.1.19082 WP_000077317.1.1911 WP_000077317.1.19301 WP_000077317.1.19322 WP_000077317.1.19430 WP_000077317.1.19450 WP_000077317.1.19555 WP_000077317.1.19577 WP_000077317.1.19611 WP_000077317.1.1964 WP_000077317.1.19643 WP_000077317.1.19701 WP_000077317.1.19732 WP_000077317.1.1974 WP_000077317.1.19748 WP_000077317.1.19792 WP_000077317.1.19816 WP_000077317.1.19848 WP_000077317.1.19891 WP_000077317.1.19912 WP_000077317.1.19921 WP_000077317.1.19980 WP_000077317.1.19981 WP_000077317.1.19982 WP_000077317.1.2 WP_000077317.1.20006 WP_000077317.1.20049 WP_000077317.1.20052 WP_000077317.1.2007 WP_000077317.1.20078 WP_000077317.1.2008 WP_000077317.1.20090 WP_000077317.1.20100 WP_000077317.1.20161 WP_000077317.1.20167 WP_000077317.1.20191 WP_000077317.1.20214 WP_000077317.1.20245 WP_000077317.1.20265 WP_000077317.1.2029 WP_000077317.1.20324 WP_000077317.1.20340 WP_000077317.1.20394 WP_000077317.1.20398 WP_000077317.1.20399 WP_000077317.1.20411 WP_000077317.1.20447 WP_000077317.1.20479 WP_000077317.1.20487 WP_000077317.1.20579 WP_000077317.1.20585 WP_000077317.1.20611 WP_000077317.1.20619 WP_000077317.1.20620 WP_000077317.1.20736 WP_000077317.1.20796 WP_000077317.1.20821 WP_000077317.1.20846 WP_000077317.1.20867 WP_000077317.1.20878 WP_000077317.1.20913 WP_000077317.1.20922 WP_000077317.1.20935 WP_000077317.1.20939 WP_000077317.1.20945 WP_000077317.1.20971 WP_000077317.1.21009 WP_000077317.1.21056 WP_000077317.1.21066 WP_000077317.1.21078 WP_000077317.1.21109 WP_000077317.1.21111 WP_000077317.1.21154 WP_000077317.1.21183 WP_000077317.1.2119 WP_000077317.1.21257 WP_000077317.1.21272 WP_000077317.1.21313 WP_000077317.1.21330 WP_000077317.1.21339 WP_000077317.1.2135 WP_000077317.1.21359 WP_000077317.1.21375 WP_000077317.1.21379 WP_000077317.1.21393 WP_000077317.1.21412 WP_000077317.1.21449 WP_000077317.1.21464 WP_000077317.1.21480 WP_000077317.1.21500 WP_000077317.1.21511 WP_000077317.1.21514 WP_000077317.1.21572 WP_000077317.1.2159 WP_000077317.1.2160 WP_000077317.1.21636 WP_000077317.1.21724 WP_000077317.1.21746 WP_000077317.1.21763 WP_000077317.1.21787 WP_000077317.1.21830 WP_000077317.1.21988 WP_000077317.1.22027 WP_000077317.1.22082 WP_000077317.1.22111 WP_000077317.1.22149 WP_000077317.1.22177 WP_000077317.1.22180 WP_000077317.1.22197 WP_000077317.1.22227 WP_000077317.1.22302 WP_000077317.1.22369 WP_000077317.1.22400 WP_000077317.1.22493 WP_000077317.1.22533 WP_000077317.1.22559 WP_000077317.1.22650 WP_000077317.1.22696 WP_000077317.1.22702 WP_000077317.1.22709 WP_000077317.1.22738 WP_000077317.1.22789 WP_000077317.1.22790 WP_000077317.1.22792 WP_000077317.1.22803 WP_000077317.1.22853 WP_000077317.1.22869 WP_000077317.1.22890 WP_000077317.1.22924 WP_000077317.1.22969 WP_000077317.1.23008 WP_000077317.1.23061 WP_000077317.1.23082 WP_000077317.1.23103 WP_000077317.1.23121 WP_000077317.1.23130 WP_000077317.1.23132 WP_000077317.1.23133 WP_000077317.1.23161 WP_000077317.1.23185 WP_000077317.1.23244 WP_000077317.1.2327 WP_000077317.1.23275 WP_000077317.1.23288 WP_000077317.1.23413 WP_000077317.1.23449 WP_000077317.1.23531 WP_000077317.1.23572 WP_000077317.1.23630 WP_000077317.1.23644 WP_000077317.1.23690 WP_000077317.1.23740 WP_000077317.1.23796 WP_000077317.1.23809 WP_000077317.1.23842 WP_000077317.1.2389 WP_000077317.1.23900 WP_000077317.1.23944 WP_000077317.1.23956 WP_000077317.1.23972 WP_000077317.1.23995 WP_000077317.1.24129 WP_000077317.1.24213 WP_000077317.1.24263 WP_000077317.1.2427 WP_000077317.1.24277 WP_000077317.1.24343 WP_000077317.1.24416 WP_000077317.1.24437 WP_000077317.1.24462 WP_000077317.1.24469 WP_000077317.1.2450 WP_000077317.1.24589 WP_000077317.1.24596 WP_000077317.1.24602 WP_000077317.1.24631 WP_000077317.1.24679 WP_000077317.1.24684 WP_000077317.1.24685 WP_000077317.1.24823 WP_000077317.1.24855 WP_000077317.1.24903 WP_000077317.1.2497 WP_000077317.1.25007 WP_000077317.1.2501 WP_000077317.1.25012 WP_000077317.1.2506 WP_000077317.1.25070 WP_000077317.1.25092 WP_000077317.1.25098 WP_000077317.1.25115 WP_000077317.1.25120 WP_000077317.1.25145 WP_000077317.1.25167 WP_000077317.1.25209 WP_000077317.1.25262 WP_000077317.1.25287 WP_000077317.1.25361 WP_000077317.1.25433 WP_000077317.1.25459 WP_000077317.1.25489 WP_000077317.1.2552 WP_000077317.1.25557 WP_000077317.1.25595 WP_000077317.1.25621 WP_000077317.1.25623 WP_000077317.1.25721 WP_000077317.1.25758 WP_000077317.1.25772 WP_000077317.1.25779 WP_000077317.1.25802 WP_000077317.1.25840 WP_000077317.1.25856 WP_000077317.1.25857 WP_000077317.1.2590 WP_000077317.1.25910 WP_000077317.1.2592 WP_000077317.1.25930 WP_000077317.1.26039 WP_000077317.1.2608 WP_000077317.1.26086 WP_000077317.1.26106 WP_000077317.1.26143 WP_000077317.1.26169 WP_000077317.1.2621 WP_000077317.1.26255 WP_000077317.1.26266 WP_000077317.1.26276 WP_000077317.1.26290 WP_000077317.1.26298 WP_000077317.1.26314 WP_000077317.1.26318 WP_000077317.1.2633 WP_000077317.1.26340 WP_000077317.1.26345 WP_000077317.1.26346 WP_000077317.1.26354 WP_000077317.1.26359 WP_000077317.1.26364 WP_000077317.1.26399 WP_000077317.1.26404 WP_000077317.1.2643 WP_000077317.1.26506 WP_000077317.1.26662 WP_000077317.1.26677 WP_000077317.1.26692 WP_000077317.1.2673 WP_000077317.1.26751 WP_000077317.1.26772 WP_000077317.1.26804 WP_000077317.1.2684 WP_000077317.1.26840 WP_000077317.1.26865 WP_000077317.1.26884 WP_000077317.1.2689 WP_000077317.1.26903 WP_000077317.1.26905 WP_000077317.1.26938 WP_000077317.1.26944 WP_000077317.1.27013 WP_000077317.1.27053 WP_000077317.1.27083 WP_000077317.1.27166 WP_000077317.1.27170 WP_000077317.1.2718 WP_000077317.1.27182 WP_000077317.1.2719 WP_000077317.1.2725 WP_000077317.1.27262 WP_000077317.1.27293 WP_000077317.1.27294 WP_000077317.1.27323 WP_000077317.1.27379 WP_000077317.1.27387 WP_000077317.1.27447 WP_000077317.1.27456 WP_000077317.1.27468 WP_000077317.1.2753 WP_000077317.1.27539 WP_000077317.1.27590 WP_000077317.1.27628 WP_000077317.1.27646 WP_000077317.1.27689 WP_000077317.1.27739 WP_000077317.1.27744 WP_000077317.1.27765 WP_000077317.1.27793 WP_000077317.1.27830 WP_000077317.1.2795 WP_000077317.1.28016 WP_000077317.1.28091 WP_000077317.1.28105 WP_000077317.1.28173 WP_000077317.1.28213 WP_000077317.1.28226 WP_000077317.1.28230 WP_000077317.1.28253 WP_000077317.1.28257 WP_000077317.1.28274 WP_000077317.1.28315 WP_000077317.1.28319 WP_000077317.1.28334 WP_000077317.1.28347 WP_000077317.1.28399 WP_000077317.1.28400 WP_000077317.1.28430 WP_000077317.1.2852 WP_000077317.1.28578 WP_000077317.1.28580 WP_000077317.1.28605 WP_000077317.1.28652 WP_000077317.1.28720 WP_000077317.1.28763 WP_000077317.1.28784 WP_000077317.1.28785 WP_000077317.1.28848 WP_000077317.1.28871 WP_000077317.1.28909 WP_000077317.1.28981 WP_000077317.1.28987 WP_000077317.1.29052 WP_000077317.1.29060 WP_000077317.1.29112 WP_000077317.1.29155 WP_000077317.1.29166 WP_000077317.1.29187 WP_000077317.1.29226 WP_000077317.1.29242 WP_000077317.1.29243 WP_000077317.1.29263 WP_000077317.1.29276 WP_000077317.1.29366 WP_000077317.1.29368 WP_000077317.1.29395 WP_000077317.1.29420 WP_000077317.1.29468 WP_000077317.1.29522 WP_000077317.1.29553 WP_000077317.1.29554 WP_000077317.1.2957 WP_000077317.1.2972 WP_000077317.1.29736 WP_000077317.1.29744 WP_000077317.1.29788 WP_000077317.1.2981 WP_000077317.1.29862 WP_000077317.1.29902 WP_000077317.1.29905 WP_000077317.1.29918 WP_000077317.1.29981 WP_000077317.1.30051 WP_000077317.1.30089 WP_000077317.1.30095 WP_000077317.1.30100 WP_000077317.1.30115 WP_000077317.1.30152 WP_000077317.1.30197 WP_000077317.1.30204 WP_000077317.1.30209 WP_000077317.1.30249 WP_000077317.1.30268 WP_000077317.1.30302 WP_000077317.1.30307 WP_000077317.1.30328 WP_000077317.1.30364 WP_000077317.1.30508 WP_000077317.1.30531 WP_000077317.1.30560 WP_000077317.1.30622 WP_000077317.1.30645 WP_000077317.1.30646 WP_000077317.1.30666 WP_000077317.1.30702 WP_000077317.1.30720 WP_000077317.1.30726 WP_000077317.1.30763 WP_000077317.1.3077 WP_000077317.1.30845 WP_000077317.1.30847 WP_000077317.1.30854 WP_000077317.1.30911 WP_000077317.1.30962 WP_000077317.1.31005 WP_000077317.1.31022 WP_000077317.1.31039 WP_000077317.1.31048 WP_000077317.1.31091 WP_000077317.1.31176 WP_000077317.1.31206 WP_000077317.1.3123 WP_000077317.1.31315 WP_000077317.1.3132 WP_000077317.1.31337 WP_000077317.1.31339 WP_000077317.1.31355 WP_000077317.1.31437 WP_000077317.1.31442 WP_000077317.1.31468 WP_000077317.1.31479 WP_000077317.1.31529 WP_000077317.1.31539 WP_000077317.1.31642 WP_000077317.1.31647 WP_000077317.1.31653 WP_000077317.1.31686 WP_000077317.1.31753 WP_000077317.1.31827 WP_000077317.1.31842 WP_000077317.1.31892 WP_000077317.1.31931 WP_000077317.1.31997 WP_000077317.1.32003 WP_000077317.1.32005 WP_000077317.1.32029 WP_000077317.1.32067 WP_000077317.1.32160 WP_000077317.1.32207 WP_000077317.1.3229 WP_000077317.1.32339 WP_000077317.1.3242 WP_000077317.1.32474 WP_000077317.1.32481 WP_000077317.1.32483 WP_000077317.1.32514 WP_000077317.1.32534 WP_000077317.1.32555 WP_000077317.1.32565 WP_000077317.1.32607 WP_000077317.1.32634 WP_000077317.1.32645 WP_000077317.1.32746 WP_000077317.1.32764 WP_000077317.1.32770 WP_000077317.1.32800 WP_000077317.1.32928 WP_000077317.1.32939 WP_000077317.1.32954 WP_000077317.1.33038 WP_000077317.1.33048 WP_000077317.1.33067 WP_000077317.1.33110 WP_000077317.1.33123 WP_000077317.1.33138 WP_000077317.1.33212 WP_000077317.1.33250 WP_000077317.1.33266 WP_000077317.1.33296 WP_000077317.1.33335 WP_000077317.1.33357 WP_000077317.1.33416 WP_000077317.1.33432 WP_000077317.1.33468 WP_000077317.1.3347 WP_000077317.1.33507 WP_000077317.1.33594 WP_000077317.1.33626 WP_000077317.1.33627 WP_000077317.1.3363 WP_000077317.1.33654 WP_000077317.1.33692 WP_000077317.1.33695 WP_000077317.1.33718 WP_000077317.1.33735 WP_000077317.1.33743 WP_000077317.1.33769 WP_000077317.1.33792 WP_000077317.1.33804 WP_000077317.1.33813 WP_000077317.1.33940 WP_000077317.1.33968 WP_000077317.1.33971 WP_000077317.1.33983 WP_000077317.1.34026 WP_000077317.1.34030 WP_000077317.1.34051 WP_000077317.1.34062 WP_000077317.1.34100 WP_000077317.1.34128 WP_000077317.1.34132 WP_000077317.1.34182 WP_000077317.1.34209 WP_000077317.1.34244 WP_000077317.1.34250 WP_000077317.1.34251 WP_000077317.1.34285 WP_000077317.1.34381 WP_000077317.1.34403 WP_000077317.1.34410 WP_000077317.1.34436 WP_000077317.1.34482 WP_000077317.1.34492 WP_000077317.1.34502 WP_000077317.1.34510 WP_000077317.1.3461 WP_000077317.1.34677 WP_000077317.1.34737 WP_000077317.1.34767 WP_000077317.1.34818 WP_000077317.1.34890 WP_000077317.1.34918 WP_000077317.1.34998 WP_000077317.1.35059 WP_000077317.1.35062 WP_000077317.1.35089 WP_000077317.1.35097 WP_000077317.1.35110 WP_000077317.1.35121 WP_000077317.1.35233 WP_000077317.1.35276 WP_000077317.1.35285 WP_000077317.1.35297 WP_000077317.1.35334 WP_000077317.1.354 WP_000077317.1.35415 WP_000077317.1.3542 WP_000077317.1.35498 WP_000077317.1.35525 WP_000077317.1.35580 WP_000077317.1.35615 WP_000077317.1.35623 WP_000077317.1.35673 WP_000077317.1.3569 WP_000077317.1.35801 WP_000077317.1.35826 WP_000077317.1.35888 WP_000077317.1.35900 WP_000077317.1.35928 WP_000077317.1.35950 WP_000077317.1.36004 WP_000077317.1.36082 WP_000077317.1.36102 WP_000077317.1.36119 WP_000077317.1.36141 WP_000077317.1.3617 WP_000077317.1.36176 WP_000077317.1.36187 WP_000077317.1.36188 WP_000077317.1.36250 WP_000077317.1.36264 WP_000077317.1.36278 WP_000077317.1.36282 WP_000077317.1.36307 WP_000077317.1.36344 WP_000077317.1.36389 WP_000077317.1.36532 WP_000077317.1.36535 WP_000077317.1.3655 WP_000077317.1.36570 WP_000077317.1.36580 WP_000077317.1.36600 WP_000077317.1.36615 WP_000077317.1.36646 WP_000077317.1.36689 WP_000077317.1.36697 WP_000077317.1.36745 WP_000077317.1.3675 WP_000077317.1.36783 WP_000077317.1.36796 WP_000077317.1.36822 WP_000077317.1.3685 WP_000077317.1.36858 WP_000077317.1.3687 WP_000077317.1.36955 WP_000077317.1.36979 WP_000077317.1.36980 WP_000077317.1.36997 WP_000077317.1.37002 WP_000077317.1.37016 WP_000077317.1.3703 WP_000077317.1.37044 WP_000077317.1.37055 WP_000077317.1.37080 WP_000077317.1.37121 WP_000077317.1.37134 WP_000077317.1.37220 WP_000077317.1.37341 WP_000077317.1.37398 WP_000077317.1.37424 WP_000077317.1.37467 WP_000077317.1.37503 WP_000077317.1.37583 WP_000077317.1.37602 WP_000077317.1.37605 WP_000077317.1.37606 WP_000077317.1.37621 WP_000077317.1.37624 WP_000077317.1.37781 WP_000077317.1.37815 WP_000077317.1.37828 WP_000077317.1.37953 WP_000077317.1.37987 WP_000077317.1.38038 WP_000077317.1.38057 WP_000077317.1.38070 WP_000077317.1.38082 WP_000077317.1.3809 WP_000077317.1.38160 WP_000077317.1.38177 WP_000077317.1.3820 WP_000077317.1.38230 WP_000077317.1.38232 WP_000077317.1.38276 WP_000077317.1.38282 WP_000077317.1.38309 WP_000077317.1.38339 WP_000077317.1.38383 WP_000077317.1.3842 WP_000077317.1.38437 WP_000077317.1.38453 WP_000077317.1.38493 WP_000077317.1.3852 WP_000077317.1.38522 WP_000077317.1.38546 WP_000077317.1.38607 WP_000077317.1.38612 WP_000077317.1.3867 WP_000077317.1.38674 WP_000077317.1.38721 WP_000077317.1.38760 WP_000077317.1.38823 WP_000077317.1.38841 WP_000077317.1.38858 WP_000077317.1.38926 WP_000077317.1.38931 WP_000077317.1.38940 WP_000077317.1.38941 WP_000077317.1.38972 WP_000077317.1.38989 WP_000077317.1.390 WP_000077317.1.39012 WP_000077317.1.39014 WP_000077317.1.39043 WP_000077317.1.39053 WP_000077317.1.3906 WP_000077317.1.391 WP_000077317.1.39108 WP_000077317.1.39203 WP_000077317.1.39206 WP_000077317.1.39217 WP_000077317.1.3926 WP_000077317.1.39272 WP_000077317.1.39290 WP_000077317.1.39332 WP_000077317.1.39333 WP_000077317.1.39397 WP_000077317.1.39406 WP_000077317.1.39451 WP_000077317.1.39486 WP_000077317.1.39506 WP_000077317.1.39550 WP_000077317.1.39645 WP_000077317.1.39687 WP_000077317.1.39689 WP_000077317.1.39697 WP_000077317.1.39711 WP_000077317.1.39738 WP_000077317.1.39767 WP_000077317.1.39789 WP_000077317.1.39832 WP_000077317.1.39838 WP_000077317.1.39856 WP_000077317.1.39869 WP_000077317.1.40014 WP_000077317.1.40043 WP_000077317.1.40099 WP_000077317.1.40120 WP_000077317.1.40137 WP_000077317.1.4015 WP_000077317.1.40173 WP_000077317.1.4019 WP_000077317.1.40318 WP_000077317.1.40320 WP_000077317.1.40330 WP_000077317.1.40340 WP_000077317.1.40342 WP_000077317.1.40368 WP_000077317.1.40406 WP_000077317.1.4045 WP_000077317.1.40472 WP_000077317.1.40474 WP_000077317.1.40481 WP_000077317.1.40505 WP_000077317.1.40531 WP_000077317.1.40532 WP_000077317.1.4056 WP_000077317.1.4057 WP_000077317.1.40579 WP_000077317.1.40588 WP_000077317.1.40620 WP_000077317.1.40644 WP_000077317.1.40655 WP_000077317.1.40658 WP_000077317.1.40659 WP_000077317.1.40760 WP_000077317.1.40797 WP_000077317.1.40816 WP_000077317.1.41064 WP_000077317.1.41084 WP_000077317.1.41094 WP_000077317.1.41119 WP_000077317.1.41129 WP_000077317.1.4115 WP_000077317.1.41178 WP_000077317.1.41208 WP_000077317.1.41241 WP_000077317.1.41255 WP_000077317.1.41289 WP_000077317.1.4129 WP_000077317.1.41426 WP_000077317.1.41432 WP_000077317.1.41433 WP_000077317.1.41499 WP_000077317.1.41558 WP_000077317.1.41567 WP_000077317.1.41582 WP_000077317.1.41623 WP_000077317.1.41647 WP_000077317.1.41674 WP_000077317.1.41839 WP_000077317.1.4188 WP_000077317.1.41898 WP_000077317.1.41935 WP_000077317.1.41943 WP_000077317.1.41989 WP_000077317.1.420 WP_000077317.1.42015 WP_000077317.1.42017 WP_000077317.1.42028 WP_000077317.1.42064 WP_000077317.1.42087 WP_000077317.1.42125 WP_000077317.1.42137 WP_000077317.1.42198 WP_000077317.1.42269 WP_000077317.1.42305 WP_000077317.1.42355 WP_000077317.1.42403 WP_000077317.1.42436 WP_000077317.1.42459 WP_000077317.1.42481 WP_000077317.1.42510 WP_000077317.1.42593 WP_000077317.1.426 WP_000077317.1.42640 WP_000077317.1.42652 WP_000077317.1.42668 WP_000077317.1.42674 WP_000077317.1.42737 WP_000077317.1.42759 WP_000077317.1.42786 WP_000077317.1.42837 WP_000077317.1.42897 WP_000077317.1.4293 WP_000077317.1.4299 WP_000077317.1.43014 WP_000077317.1.43047 WP_000077317.1.43072 WP_000077317.1.43122 WP_000077317.1.43131 WP_000077317.1.43134 WP_000077317.1.43143 WP_000077317.1.43147 WP_000077317.1.43159 WP_000077317.1.43165 WP_000077317.1.43202 WP_000077317.1.43232 WP_000077317.1.43248 WP_000077317.1.4325 WP_000077317.1.43263 WP_000077317.1.4327 WP_000077317.1.43274 WP_000077317.1.43323 WP_000077317.1.43341 WP_000077317.1.43349 WP_000077317.1.43369 WP_000077317.1.4337 WP_000077317.1.43406 WP_000077317.1.4341 WP_000077317.1.43460 WP_000077317.1.4347 WP_000077317.1.43550 WP_000077317.1.43560 WP_000077317.1.43617 WP_000077317.1.43618 WP_000077317.1.43627 WP_000077317.1.43659 WP_000077317.1.43670 WP_000077317.1.43702 WP_000077317.1.43703 WP_000077317.1.4372 WP_000077317.1.43731 WP_000077317.1.43752 WP_000077317.1.43788 WP_000077317.1.43819 WP_000077317.1.43827 WP_000077317.1.4385 WP_000077317.1.43904 WP_000077317.1.43915 WP_000077317.1.44119 WP_000077317.1.44153 WP_000077317.1.44181 WP_000077317.1.44195 WP_000077317.1.44265 WP_000077317.1.44302 WP_000077317.1.44388 WP_000077317.1.44396 WP_000077317.1.44405 WP_000077317.1.44420 WP_000077317.1.44517 WP_000077317.1.44544 WP_000077317.1.44579 WP_000077317.1.44588 WP_000077317.1.44605 WP_000077317.1.44631 WP_000077317.1.44672 WP_000077317.1.44732 WP_000077317.1.44755 WP_000077317.1.44780 WP_000077317.1.44785 WP_000077317.1.44788 WP_000077317.1.44796 WP_000077317.1.44881 WP_000077317.1.44882 WP_000077317.1.44914 WP_000077317.1.44955 WP_000077317.1.44969 WP_000077317.1.45033 WP_000077317.1.45035 WP_000077317.1.45099 WP_000077317.1.4513 WP_000077317.1.45133 WP_000077317.1.45164 WP_000077317.1.45170 WP_000077317.1.45272 WP_000077317.1.45290 WP_000077317.1.45297 WP_000077317.1.453 WP_000077317.1.45364 WP_000077317.1.45419 WP_000077317.1.45431 WP_000077317.1.45439 WP_000077317.1.45472 WP_000077317.1.4550 WP_000077317.1.45507 WP_000077317.1.45560 WP_000077317.1.45577 WP_000077317.1.45654 WP_000077317.1.45670 WP_000077317.1.45703 WP_000077317.1.45730 WP_000077317.1.45768 WP_000077317.1.45771 WP_000077317.1.45780 WP_000077317.1.4584 WP_000077317.1.45852 WP_000077317.1.45897 WP_000077317.1.45954 WP_000077317.1.4598 WP_000077317.1.46003 WP_000077317.1.46005 WP_000077317.1.46055 WP_000077317.1.46087 WP_000077317.1.46168 WP_000077317.1.46208 WP_000077317.1.46222 WP_000077317.1.46228 WP_000077317.1.46276 WP_000077317.1.46330 WP_000077317.1.46334 WP_000077317.1.46362 WP_000077317.1.46368 WP_000077317.1.46380 WP_000077317.1.46389 WP_000077317.1.46401 WP_000077317.1.46422 WP_000077317.1.46465 WP_000077317.1.46543 WP_000077317.1.4662 WP_000077317.1.46660 WP_000077317.1.46664 WP_000077317.1.46670 WP_000077317.1.46692 WP_000077317.1.46702 WP_000077317.1.46703 WP_000077317.1.46765 WP_000077317.1.46852 WP_000077317.1.46881 WP_000077317.1.46908 WP_000077317.1.46911 WP_000077317.1.46925 WP_000077317.1.46937 WP_000077317.1.4696 WP_000077317.1.46995 WP_000077317.1.47051 WP_000077317.1.47065 WP_000077317.1.47128 WP_000077317.1.47153 WP_000077317.1.47159 WP_000077317.1.47163 WP_000077317.1.47175 WP_000077317.1.47187 WP_000077317.1.47193 WP_000077317.1.47211 WP_000077317.1.47216 WP_000077317.1.47258 WP_000077317.1.47269 WP_000077317.1.47279 WP_000077317.1.4728 WP_000077317.1.47290 WP_000077317.1.47294 WP_000077317.1.47306 WP_000077317.1.47328 WP_000077317.1.47381 WP_000077317.1.47399 WP_000077317.1.47406 WP_000077317.1.47426 WP_000077317.1.47432 WP_000077317.1.47439 WP_000077317.1.47560 WP_000077317.1.47618 WP_000077317.1.4767 WP_000077317.1.477 WP_000077317.1.47763 WP_000077317.1.47782 WP_000077317.1.47835 WP_000077317.1.47836 WP_000077317.1.47859 WP_000077317.1.47872 WP_000077317.1.47873 WP_000077317.1.47904 WP_000077317.1.47996 WP_000077317.1.48011 WP_000077317.1.48030 WP_000077317.1.48047 WP_000077317.1.4805 WP_000077317.1.48149 WP_000077317.1.4815 WP_000077317.1.48154 WP_000077317.1.48169 WP_000077317.1.48186 WP_000077317.1.48205 WP_000077317.1.48227 WP_000077317.1.48236 WP_000077317.1.48250 WP_000077317.1.48284 WP_000077317.1.48293 WP_000077317.1.48307 WP_000077317.1.48322 WP_000077317.1.48391 WP_000077317.1.48394 WP_000077317.1.48463 WP_000077317.1.48563 WP_000077317.1.48577 WP_000077317.1.48593 WP_000077317.1.48634 WP_000077317.1.48656 WP_000077317.1.4868 WP_000077317.1.48705 WP_000077317.1.48711 WP_000077317.1.48805 WP_000077317.1.48823 WP_000077317.1.48833 WP_000077317.1.48835 WP_000077317.1.4886 WP_000077317.1.48936 WP_000077317.1.48941 WP_000077317.1.48945 WP_000077317.1.48951 WP_000077317.1.48968 WP_000077317.1.48982 WP_000077317.1.48993 WP_000077317.1.4901 WP_000077317.1.4905 WP_000077317.1.49128 WP_000077317.1.49129 WP_000077317.1.49159 WP_000077317.1.4916 WP_000077317.1.49161 WP_000077317.1.4917 WP_000077317.1.4918 WP_000077317.1.49207 WP_000077317.1.49248 WP_000077317.1.49327 WP_000077317.1.49398 WP_000077317.1.4950 WP_000077317.1.4962 WP_000077317.1.49653 WP_000077317.1.49669 WP_000077317.1.49730 WP_000077317.1.49742 WP_000077317.1.4980 WP_000077317.1.49800 WP_000077317.1.4982 WP_000077317.1.49860 WP_000077317.1.49863 WP_000077317.1.49871 WP_000077317.1.4989 WP_000077317.1.49894 WP_000077317.1.49907 WP_000077317.1.49934 WP_000077317.1.4994 WP_000077317.1.49970 WP_000077317.1.49982 WP_000077317.1.50013 WP_000077317.1.50038 WP_000077317.1.50039 WP_000077317.1.50061 WP_000077317.1.50076 WP_000077317.1.5013 WP_000077317.1.50138 WP_000077317.1.50217 WP_000077317.1.50219 WP_000077317.1.50261 WP_000077317.1.50313 WP_000077317.1.50314 WP_000077317.1.50356 WP_000077317.1.50369 WP_000077317.1.50425 WP_000077317.1.50430 WP_000077317.1.50536 WP_000077317.1.50555 WP_000077317.1.50578 WP_000077317.1.50595 WP_000077317.1.50660 WP_000077317.1.50768 WP_000077317.1.50799 WP_000077317.1.50820 WP_000077317.1.5087 WP_000077317.1.50884 WP_000077317.1.50896 WP_000077317.1.50937 WP_000077317.1.50962 WP_000077317.1.5109 WP_000077317.1.5110 WP_000077317.1.5111 WP_000077317.1.51152 WP_000077317.1.51236 WP_000077317.1.51245 WP_000077317.1.51250 WP_000077317.1.51282 WP_000077317.1.51295 WP_000077317.1.51306 WP_000077317.1.51310 WP_000077317.1.51346 WP_000077317.1.51376 WP_000077317.1.51403 WP_000077317.1.51454 WP_000077317.1.51456 WP_000077317.1.51492 WP_000077317.1.515 WP_000077317.1.51527 WP_000077317.1.5155 WP_000077317.1.51559 WP_000077317.1.51575 WP_000077317.1.51590 WP_000077317.1.51665 WP_000077317.1.51716 WP_000077317.1.51744 WP_000077317.1.51748 WP_000077317.1.51797 WP_000077317.1.51836 WP_000077317.1.51842 WP_000077317.1.51844 WP_000077317.1.51871 WP_000077317.1.51883 WP_000077317.1.51912 WP_000077317.1.51924 WP_000077317.1.51936 WP_000077317.1.51952 WP_000077317.1.51971 WP_000077317.1.51995 WP_000077317.1.52078 WP_000077317.1.521 WP_000077317.1.5213 WP_000077317.1.52151 WP_000077317.1.52182 WP_000077317.1.52185 WP_000077317.1.52193 WP_000077317.1.52224 WP_000077317.1.52251 WP_000077317.1.52296 WP_000077317.1.523 WP_000077317.1.5231 WP_000077317.1.52322 WP_000077317.1.52327 WP_000077317.1.52331 WP_000077317.1.52340 WP_000077317.1.52440 WP_000077317.1.52442 WP_000077317.1.52463 WP_000077317.1.52518 WP_000077317.1.52548 WP_000077317.1.52595 WP_000077317.1.52623 WP_000077317.1.52624 WP_000077317.1.52633 WP_000077317.1.52645 WP_000077317.1.52670 WP_000077317.1.52687 WP_000077317.1.52699 WP_000077317.1.52715 WP_000077317.1.52722 WP_000077317.1.52848 WP_000077317.1.52877 WP_000077317.1.52878 WP_000077317.1.52941 WP_000077317.1.52947 WP_000077317.1.52984 WP_000077317.1.53002 WP_000077317.1.53071 WP_000077317.1.53140 WP_000077317.1.53153 WP_000077317.1.53178 WP_000077317.1.53209 WP_000077317.1.53260 WP_000077317.1.53317 WP_000077317.1.53319 WP_000077317.1.53387 WP_000077317.1.53394 WP_000077317.1.53403 WP_000077317.1.53432 WP_000077317.1.53462 WP_000077317.1.53521 WP_000077317.1.53577 WP_000077317.1.53641 WP_000077317.1.53648 WP_000077317.1.53671 WP_000077317.1.53691 WP_000077317.1.53766 WP_000077317.1.53827 WP_000077317.1.53835 WP_000077317.1.53889 WP_000077317.1.53915 WP_000077317.1.53934 WP_000077317.1.53969 WP_000077317.1.53999 WP_000077317.1.5401 WP_000077317.1.54022 WP_000077317.1.54109 WP_000077317.1.54147 WP_000077317.1.54229 WP_000077317.1.54253 WP_000077317.1.54297 WP_000077317.1.54395 WP_000077317.1.544 WP_000077317.1.54413 WP_000077317.1.54491 WP_000077317.1.54503 WP_000077317.1.54510 WP_000077317.1.54551 WP_000077317.1.54637 WP_000077317.1.54675 WP_000077317.1.5469 WP_000077317.1.54745 WP_000077317.1.54753 WP_000077317.1.54878 WP_000077317.1.54955 WP_000077317.1.55014 WP_000077317.1.55058 WP_000077317.1.55100 WP_000077317.1.5519 WP_000077317.1.55214 WP_000077317.1.55272 WP_000077317.1.55274 WP_000077317.1.55309 WP_000077317.1.55367 WP_000077317.1.55369 WP_000077317.1.55403 WP_000077317.1.55405 WP_000077317.1.55421 WP_000077317.1.55508 WP_000077317.1.5554 WP_000077317.1.55544 WP_000077317.1.55558 WP_000077317.1.5556 WP_000077317.1.55583 WP_000077317.1.5559 WP_000077317.1.5562 WP_000077317.1.55637 WP_000077317.1.55653 WP_000077317.1.557 WP_000077317.1.55728 WP_000077317.1.55784 WP_000077317.1.55786 WP_000077317.1.5580 WP_000077317.1.55818 WP_000077317.1.55831 WP_000077317.1.55835 WP_000077317.1.55867 WP_000077317.1.55886 WP_000077317.1.5589 WP_000077317.1.55904 WP_000077317.1.55916 WP_000077317.1.55933 WP_000077317.1.55953 WP_000077317.1.56000 WP_000077317.1.56025 WP_000077317.1.56048 WP_000077317.1.56078 WP_000077317.1.56098 WP_000077317.1.56225 WP_000077317.1.5623 WP_000077317.1.56239 WP_000077317.1.56281 WP_000077317.1.56332 WP_000077317.1.56333 WP_000077317.1.5635 WP_000077317.1.56400 WP_000077317.1.5644 WP_000077317.1.56558 WP_000077317.1.5658 WP_000077317.1.56584 WP_000077317.1.56598 WP_000077317.1.566 WP_000077317.1.56628 WP_000077317.1.56641 WP_000077317.1.56658 WP_000077317.1.5666 WP_000077317.1.56767 WP_000077317.1.5677 WP_000077317.1.56778 WP_000077317.1.56794 WP_000077317.1.56815 WP_000077317.1.56856 WP_000077317.1.5686 WP_000077317.1.56865 WP_000077317.1.56878 WP_000077317.1.569 WP_000077317.1.56986 WP_000077317.1.57047 WP_000077317.1.57073 WP_000077317.1.57075 WP_000077317.1.57097 WP_000077317.1.57109 WP_000077317.1.57170 WP_000077317.1.5718 WP_000077317.1.57190 WP_000077317.1.57214 WP_000077317.1.57265 WP_000077317.1.57309 WP_000077317.1.57445 WP_000077317.1.57481 WP_000077317.1.57594 WP_000077317.1.57650 WP_000077317.1.57665 WP_000077317.1.57682 WP_000077317.1.57692 WP_000077317.1.57730 WP_000077317.1.57734 WP_000077317.1.57754 WP_000077317.1.57808 WP_000077317.1.57819 WP_000077317.1.57837 WP_000077317.1.57840 WP_000077317.1.57861 WP_000077317.1.57878 WP_000077317.1.5791 WP_000077317.1.57943 WP_000077317.1.57952 WP_000077317.1.57974 WP_000077317.1.58016 WP_000077317.1.58035 WP_000077317.1.58049 WP_000077317.1.58074 WP_000077317.1.58116 WP_000077317.1.58127 WP_000077317.1.58148 WP_000077317.1.58158 WP_000077317.1.5816 WP_000077317.1.58277 WP_000077317.1.58317 WP_000077317.1.58352 WP_000077317.1.58364 WP_000077317.1.58395 WP_000077317.1.58430 WP_000077317.1.58512 WP_000077317.1.58530 WP_000077317.1.5857 WP_000077317.1.58571 WP_000077317.1.58592 WP_000077317.1.58598 WP_000077317.1.58704 WP_000077317.1.58735 WP_000077317.1.58760 WP_000077317.1.58763 WP_000077317.1.58772 WP_000077317.1.5880 WP_000077317.1.58833 WP_000077317.1.58855 WP_000077317.1.58934 WP_000077317.1.58981 WP_000077317.1.59011 WP_000077317.1.59014 WP_000077317.1.59039 WP_000077317.1.59077 WP_000077317.1.59124 WP_000077317.1.59146 WP_000077317.1.5920 WP_000077317.1.59311 WP_000077317.1.59398 WP_000077317.1.5940 WP_000077317.1.59404 WP_000077317.1.59462 WP_000077317.1.59464 WP_000077317.1.59489 WP_000077317.1.59498 WP_000077317.1.59540 WP_000077317.1.59598 WP_000077317.1.59668 WP_000077317.1.59669 WP_000077317.1.59671 WP_000077317.1.5972 WP_000077317.1.59787 WP_000077317.1.5982 WP_000077317.1.59822 WP_000077317.1.59874 WP_000077317.1.59907 WP_000077317.1.59915 WP_000077317.1.60006 WP_000077317.1.6006 WP_000077317.1.6011 WP_000077317.1.60123 WP_000077317.1.60147 WP_000077317.1.60149 WP_000077317.1.60157 WP_000077317.1.6017 WP_000077317.1.60227 WP_000077317.1.60302 WP_000077317.1.60353 WP_000077317.1.60360 WP_000077317.1.60431 WP_000077317.1.60434 WP_000077317.1.60492 WP_000077317.1.60547 WP_000077317.1.60585 WP_000077317.1.60595 WP_000077317.1.60636 WP_000077317.1.60641 WP_000077317.1.60734 WP_000077317.1.60750 WP_000077317.1.60751 WP_000077317.1.60758 WP_000077317.1.60759 WP_000077317.1.60765 WP_000077317.1.60778 WP_000077317.1.60813 WP_000077317.1.60820 WP_000077317.1.60845 WP_000077317.1.6085 WP_000077317.1.60869 WP_000077317.1.60888 WP_000077317.1.60912 WP_000077317.1.60923 WP_000077317.1.60948 WP_000077317.1.60965 WP_000077317.1.60991 WP_000077317.1.61013 WP_000077317.1.61023 WP_000077317.1.61026 WP_000077317.1.61029 WP_000077317.1.61031 WP_000077317.1.61082 WP_000077317.1.61115 WP_000077317.1.61139 WP_000077317.1.61189 WP_000077317.1.6119 WP_000077317.1.6123 WP_000077317.1.61263 WP_000077317.1.61271 WP_000077317.1.61286 WP_000077317.1.61289 WP_000077317.1.61313 WP_000077317.1.61316 WP_000077317.1.6136 WP_000077317.1.61375 WP_000077317.1.61393 WP_000077317.1.61430 WP_000077317.1.61439 WP_000077317.1.61440 WP_000077317.1.61555 WP_000077317.1.61585 WP_000077317.1.61597 WP_000077317.1.61615 WP_000077317.1.61639 WP_000077317.1.6166 WP_000077317.1.61705 WP_000077317.1.61749 WP_000077317.1.61800 WP_000077317.1.61802 WP_000077317.1.61831 WP_000077317.1.61838 WP_000077317.1.619 WP_000077317.1.61903 WP_000077317.1.61936 WP_000077317.1.61978 WP_000077317.1.62002 WP_000077317.1.6201 WP_000077317.1.62028 WP_000077317.1.62069 WP_000077317.1.62071 WP_000077317.1.62096 WP_000077317.1.62247 WP_000077317.1.62254 WP_000077317.1.62346 WP_000077317.1.62352 WP_000077317.1.62382 WP_000077317.1.62398 WP_000077317.1.62429 WP_000077317.1.62453 WP_000077317.1.62474 WP_000077317.1.62496 WP_000077317.1.6250 WP_000077317.1.62553 WP_000077317.1.62602 WP_000077317.1.62625 WP_000077317.1.62671 WP_000077317.1.62674 WP_000077317.1.6268 WP_000077317.1.62684 WP_000077317.1.62723 WP_000077317.1.62764 WP_000077317.1.62771 WP_000077317.1.62822 WP_000077317.1.62824 WP_000077317.1.62831 WP_000077317.1.62863 WP_000077317.1.62880 WP_000077317.1.62970 WP_000077317.1.63003 WP_000077317.1.63027 WP_000077317.1.63052 WP_000077317.1.63070 WP_000077317.1.63083 WP_000077317.1.63139 WP_000077317.1.63140 WP_000077317.1.63220 WP_000077317.1.63266 WP_000077317.1.63289 WP_000077317.1.63304 WP_000077317.1.63313 WP_000077317.1.63322 WP_000077317.1.63333 WP_000077317.1.63341 WP_000077317.1.634 WP_000077317.1.63441 WP_000077317.1.63469 WP_000077317.1.63471 WP_000077317.1.63589 WP_000077317.1.63673 WP_000077317.1.63678 WP_000077317.1.63726 WP_000077317.1.63729 WP_000077317.1.6374 WP_000077317.1.63751 WP_000077317.1.63759 WP_000077317.1.63774 WP_000077317.1.63828 WP_000077317.1.6388 WP_000077317.1.63907 WP_000077317.1.6403 WP_000077317.1.6408 WP_000077317.1.64192 WP_000077317.1.64250 WP_000077317.1.64367 WP_000077317.1.6438 WP_000077317.1.64456 WP_000077317.1.64457 WP_000077317.1.64473 WP_000077317.1.64525 WP_000077317.1.64565 WP_000077317.1.64583 WP_000077317.1.6459 WP_000077317.1.6462 WP_000077317.1.64631 WP_000077317.1.64677 WP_000077317.1.64686 WP_000077317.1.64720 WP_000077317.1.64765 WP_000077317.1.6479 WP_000077317.1.64858 WP_000077317.1.64879 WP_000077317.1.6488 WP_000077317.1.64893 WP_000077317.1.64897 WP_000077317.1.64928 WP_000077317.1.64935 WP_000077317.1.64961 WP_000077317.1.65044 WP_000077317.1.65132 WP_000077317.1.65158 WP_000077317.1.65180 WP_000077317.1.65193 WP_000077317.1.65217 WP_000077317.1.65243 WP_000077317.1.65317 WP_000077317.1.65367 WP_000077317.1.65419 WP_000077317.1.65423 WP_000077317.1.65432 WP_000077317.1.65443 WP_000077317.1.65451 WP_000077317.1.6547 WP_000077317.1.65504 WP_000077317.1.6551 WP_000077317.1.65520 WP_000077317.1.65544 WP_000077317.1.65675 WP_000077317.1.65689 WP_000077317.1.65693 WP_000077317.1.65700 WP_000077317.1.65703 WP_000077317.1.65705 WP_000077317.1.65856 WP_000077317.1.65922 WP_000077317.1.65931 WP_000077317.1.66009 WP_000077317.1.66081 WP_000077317.1.661 WP_000077317.1.66120 WP_000077317.1.66133 WP_000077317.1.66175 WP_000077317.1.66262 WP_000077317.1.66302 WP_000077317.1.66433 WP_000077317.1.66505 WP_000077317.1.66519 WP_000077317.1.66542 WP_000077317.1.66564 WP_000077317.1.66588 WP_000077317.1.66601 WP_000077317.1.66606 WP_000077317.1.6662 WP_000077317.1.66664 WP_000077317.1.66677 WP_000077317.1.66711 WP_000077317.1.6674 WP_000077317.1.66786 WP_000077317.1.66818 WP_000077317.1.6684 WP_000077317.1.66879 WP_000077317.1.67112 WP_000077317.1.67135 WP_000077317.1.67191 WP_000077317.1.6722 WP_000077317.1.67266 WP_000077317.1.67329 WP_000077317.1.67333 WP_000077317.1.67379 WP_000077317.1.6740 WP_000077317.1.67414 WP_000077317.1.67463 WP_000077317.1.67480 WP_000077317.1.67505 WP_000077317.1.67507 WP_000077317.1.67520 WP_000077317.1.67521 WP_000077317.1.67554 WP_000077317.1.67572 WP_000077317.1.67632 WP_000077317.1.67651 WP_000077317.1.67652 WP_000077317.1.67713 WP_000077317.1.67722 WP_000077317.1.67754 WP_000077317.1.67815 WP_000077317.1.6786 WP_000077317.1.67865 WP_000077317.1.67925 WP_000077317.1.67986 WP_000077317.1.68033 WP_000077317.1.68054 WP_000077317.1.68066 WP_000077317.1.6811 WP_000077317.1.68111 WP_000077317.1.68160 WP_000077317.1.68161 WP_000077317.1.68199 WP_000077317.1.68261 WP_000077317.1.68295 WP_000077317.1.68296 WP_000077317.1.6830 WP_000077317.1.68307 WP_000077317.1.6834 WP_000077317.1.68343 WP_000077317.1.68351 WP_000077317.1.68367 WP_000077317.1.6839 WP_000077317.1.68397 WP_000077317.1.68404 WP_000077317.1.68425 WP_000077317.1.68483 WP_000077317.1.68489 WP_000077317.1.68522 WP_000077317.1.68565 WP_000077317.1.68636 WP_000077317.1.68650 WP_000077317.1.68699 WP_000077317.1.68703 WP_000077317.1.68728 WP_000077317.1.68737 WP_000077317.1.68775 WP_000077317.1.68813 WP_000077317.1.68831 WP_000077317.1.68854 WP_000077317.1.68875 WP_000077317.1.68943 WP_000077317.1.68944 WP_000077317.1.69045 WP_000077317.1.69087 WP_000077317.1.69089 WP_000077317.1.691 WP_000077317.1.6917 WP_000077317.1.69191 WP_000077317.1.69222 WP_000077317.1.69237 WP_000077317.1.69366 WP_000077317.1.69395 WP_000077317.1.69415 WP_000077317.1.69476 WP_000077317.1.69480 WP_000077317.1.695 WP_000077317.1.6953 WP_000077317.1.69552 WP_000077317.1.69563 WP_000077317.1.69622 WP_000077317.1.69679 WP_000077317.1.69877 WP_000077317.1.69878 WP_000077317.1.69921 WP_000077317.1.69987 WP_000077317.1.70024 WP_000077317.1.70048 WP_000077317.1.70089 WP_000077317.1.70105 WP_000077317.1.7012 WP_000077317.1.70133 WP_000077317.1.70210 WP_000077317.1.7024 WP_000077317.1.70253 WP_000077317.1.70273 WP_000077317.1.703 WP_000077317.1.7034 WP_000077317.1.70344 WP_000077317.1.70349 WP_000077317.1.7043 WP_000077317.1.70451 WP_000077317.1.70459 WP_000077317.1.70462 WP_000077317.1.7053 WP_000077317.1.70546 WP_000077317.1.7061 WP_000077317.1.70635 WP_000077317.1.70641 WP_000077317.1.7067 WP_000077317.1.7073 WP_000077317.1.70818 WP_000077317.1.70823 WP_000077317.1.70855 WP_000077317.1.70924 WP_000077317.1.70930 WP_000077317.1.70943 WP_000077317.1.71043 WP_000077317.1.71058 WP_000077317.1.71059 WP_000077317.1.71073 WP_000077317.1.7109 WP_000077317.1.71130 WP_000077317.1.71196 WP_000077317.1.7120 WP_000077317.1.71257 WP_000077317.1.71295 WP_000077317.1.71298 WP_000077317.1.71325 WP_000077317.1.71345 WP_000077317.1.71359 WP_000077317.1.71463 WP_000077317.1.7150 WP_000077317.1.71519 WP_000077317.1.71529 WP_000077317.1.71543 WP_000077317.1.71596 WP_000077317.1.7161 WP_000077317.1.71662 WP_000077317.1.71676 WP_000077317.1.71735 WP_000077317.1.71780 WP_000077317.1.7179 WP_000077317.1.71861 WP_000077317.1.71925 WP_000077317.1.71989 WP_000077317.1.72026 WP_000077317.1.72031 WP_000077317.1.72067 WP_000077317.1.72169 WP_000077317.1.72205 WP_000077317.1.72271 WP_000077317.1.72330 WP_000077317.1.72347 WP_000077317.1.7236 WP_000077317.1.72366 WP_000077317.1.72424 WP_000077317.1.72547 WP_000077317.1.72626 WP_000077317.1.72654 WP_000077317.1.72750 WP_000077317.1.72787 WP_000077317.1.72834 WP_000077317.1.72835 WP_000077317.1.72903 WP_000077317.1.72904 WP_000077317.1.72935 WP_000077317.1.72945 WP_000077317.1.73017 WP_000077317.1.73019 WP_000077317.1.73022 WP_000077317.1.73037 WP_000077317.1.73122 WP_000077317.1.73132 WP_000077317.1.73265 WP_000077317.1.73286 WP_000077317.1.73386 WP_000077317.1.73456 WP_000077317.1.73501 WP_000077317.1.73571 WP_000077317.1.73591 WP_000077317.1.736 WP_000077317.1.73639 WP_000077317.1.73685 WP_000077317.1.73735 WP_000077317.1.73759 WP_000077317.1.73786 WP_000077317.1.7380 WP_000077317.1.73834 WP_000077317.1.73858 WP_000077317.1.73910 WP_000077317.1.73920 WP_000077317.1.73961 WP_000077317.1.73969 WP_000077317.1.73976 WP_000077317.1.73983 WP_000077317.1.74010 WP_000077317.1.74027 WP_000077317.1.74081 WP_000077317.1.74157 WP_000077317.1.74161 WP_000077317.1.74172 WP_000077317.1.74173 WP_000077317.1.74183 WP_000077317.1.74216 WP_000077317.1.74234 WP_000077317.1.74237 WP_000077317.1.7427 WP_000077317.1.7434 WP_000077317.1.74353 WP_000077317.1.74356 WP_000077317.1.74380 WP_000077317.1.74429 WP_000077317.1.74457 WP_000077317.1.74533 WP_000077317.1.7457 WP_000077317.1.74587 WP_000077317.1.74610 WP_000077317.1.74638 WP_000077317.1.74696 WP_000077317.1.74704 WP_000077317.1.74731 WP_000077317.1.74747 WP_000077317.1.74802 WP_000077317.1.74866 WP_000077317.1.74890 WP_000077317.1.74911 WP_000077317.1.74922 WP_000077317.1.74961 WP_000077317.1.74994 WP_000077317.1.74999 WP_000077317.1.75038 WP_000077317.1.75044 WP_000077317.1.75048 WP_000077317.1.75052 WP_000077317.1.75093 WP_000077317.1.75141 WP_000077317.1.75186 WP_000077317.1.75227 WP_000077317.1.75252 WP_000077317.1.75253 WP_000077317.1.75294 WP_000077317.1.75298 WP_000077317.1.75320 WP_000077317.1.75327 WP_000077317.1.75349 WP_000077317.1.75365 WP_000077317.1.75399 WP_000077317.1.7542 WP_000077317.1.75438 WP_000077317.1.75440 WP_000077317.1.75527 WP_000077317.1.75551 WP_000077317.1.7561 WP_000077317.1.75649 WP_000077317.1.75652 WP_000077317.1.75685 WP_000077317.1.75769 WP_000077317.1.75775 WP_000077317.1.758 WP_000077317.1.75830 WP_000077317.1.75881 WP_000077317.1.75885 WP_000077317.1.75929 WP_000077317.1.75952 WP_000077317.1.7596 WP_000077317.1.75969 WP_000077317.1.76010 WP_000077317.1.76015 WP_000077317.1.76095 WP_000077317.1.76143 WP_000077317.1.76230 WP_000077317.1.76234 WP_000077317.1.7624 WP_000077317.1.7625 WP_000077317.1.76258 WP_000077317.1.76261 WP_000077317.1.76282 WP_000077317.1.76332 WP_000077317.1.76337 WP_000077317.1.76351 WP_000077317.1.76419 WP_000077317.1.76420 WP_000077317.1.76421 WP_000077317.1.76606 WP_000077317.1.76624 WP_000077317.1.76648 WP_000077317.1.76686 WP_000077317.1.76690 WP_000077317.1.76693 WP_000077317.1.7675 WP_000077317.1.76790 WP_000077317.1.76792 WP_000077317.1.768 WP_000077317.1.76816 WP_000077317.1.76839 WP_000077317.1.76845 WP_000077317.1.76897 WP_000077317.1.76921 WP_000077317.1.76944 WP_000077317.1.76952 WP_000077317.1.76998 WP_000077317.1.77031 WP_000077317.1.77041 WP_000077317.1.77050 WP_000077317.1.77060 WP_000077317.1.77062 WP_000077317.1.77112 WP_000077317.1.77145 WP_000077317.1.77305 WP_000077317.1.7745 WP_000077317.1.7746 WP_000077317.1.77489 WP_000077317.1.77497 WP_000077317.1.7752 WP_000077317.1.77520 WP_000077317.1.77527 WP_000077317.1.77533 WP_000077317.1.77572 WP_000077317.1.77603 WP_000077317.1.77606 WP_000077317.1.77738 WP_000077317.1.7774 WP_000077317.1.77743 WP_000077317.1.77818 WP_000077317.1.77822 WP_000077317.1.77848 WP_000077317.1.77858 WP_000077317.1.7787 WP_000077317.1.77952 WP_000077317.1.77957 WP_000077317.1.78054 WP_000077317.1.78091 WP_000077317.1.78095 WP_000077317.1.7810 WP_000077317.1.78173 WP_000077317.1.78189 WP_000077317.1.78207 WP_000077317.1.78208 WP_000077317.1.78252 WP_000077317.1.78254 WP_000077317.1.78257 WP_000077317.1.7827 WP_000077317.1.78311 WP_000077317.1.78332 WP_000077317.1.78365 WP_000077317.1.78404 WP_000077317.1.7850 WP_000077317.1.78558 WP_000077317.1.7857 WP_000077317.1.78604 WP_000077317.1.78653 WP_000077317.1.78667 WP_000077317.1.78728 WP_000077317.1.78803 WP_000077317.1.78819 WP_000077317.1.78841 WP_000077317.1.78897 WP_000077317.1.78946 WP_000077317.1.78983 WP_000077317.1.7900 WP_000077317.1.79006 WP_000077317.1.79038 WP_000077317.1.79051 WP_000077317.1.79085 WP_000077317.1.79131 WP_000077317.1.79170 WP_000077317.1.79208 WP_000077317.1.79223 WP_000077317.1.7931 WP_000077317.1.79310 WP_000077317.1.79314 WP_000077317.1.79322 WP_000077317.1.79332 WP_000077317.1.79374 WP_000077317.1.79408 WP_000077317.1.79436 WP_000077317.1.79461 WP_000077317.1.79476 WP_000077317.1.79487 WP_000077317.1.79539 WP_000077317.1.79556 WP_000077317.1.79626 WP_000077317.1.79662 WP_000077317.1.79672 WP_000077317.1.79676 WP_000077317.1.79706 WP_000077317.1.79822 WP_000077317.1.79831 WP_000077317.1.79834 WP_000077317.1.79837 WP_000077317.1.7989 WP_000077317.1.79896 WP_000077317.1.79911 WP_000077317.1.7992 WP_000077317.1.79941 WP_000077317.1.79961 WP_000077317.1.79971 WP_000077317.1.79991 WP_000077317.1.80000 WP_000077317.1.80032 WP_000077317.1.80042 WP_000077317.1.80079 WP_000077317.1.80109 WP_000077317.1.80127 WP_000077317.1.80203 WP_000077317.1.80287 WP_000077317.1.80290 WP_000077317.1.8031 WP_000077317.1.8035 WP_000077317.1.80358 WP_000077317.1.80378 WP_000077317.1.8043 WP_000077317.1.80472 WP_000077317.1.80530 WP_000077317.1.8065 WP_000077317.1.80653 WP_000077317.1.80687 WP_000077317.1.80717 WP_000077317.1.80761 WP_000077317.1.80763 WP_000077317.1.80781 WP_000077317.1.80786 WP_000077317.1.80833 WP_000077317.1.8084 WP_000077317.1.80855 WP_000077317.1.80872 WP_000077317.1.80962 WP_000077317.1.81085 WP_000077317.1.81157 WP_000077317.1.81171 WP_000077317.1.81234 WP_000077317.1.8125 WP_000077317.1.81252 WP_000077317.1.81344 WP_000077317.1.8135 WP_000077317.1.81384 WP_000077317.1.81385 WP_000077317.1.81389 WP_000077317.1.8142 WP_000077317.1.8144 WP_000077317.1.81464 WP_000077317.1.81467 WP_000077317.1.81599 WP_000077317.1.81610 WP_000077317.1.81718 WP_000077317.1.81740 WP_000077317.1.81758 WP_000077317.1.81800 WP_000077317.1.81810 WP_000077317.1.81812 WP_000077317.1.81831 WP_000077317.1.81861 WP_000077317.1.81870 WP_000077317.1.81897 WP_000077317.1.81903 WP_000077317.1.81905 WP_000077317.1.81906 WP_000077317.1.81919 WP_000077317.1.81944 WP_000077317.1.81955 WP_000077317.1.81999 WP_000077317.1.82009 WP_000077317.1.82053 WP_000077317.1.82121 WP_000077317.1.82219 WP_000077317.1.82247 WP_000077317.1.82259 WP_000077317.1.82278 WP_000077317.1.82340 WP_000077317.1.82354 WP_000077317.1.82358 WP_000077317.1.82368 WP_000077317.1.82447 WP_000077317.1.82467 WP_000077317.1.82548 WP_000077317.1.82612 WP_000077317.1.8265 WP_000077317.1.82709 WP_000077317.1.82724 WP_000077317.1.82796 WP_000077317.1.8280 WP_000077317.1.82802 WP_000077317.1.82829 WP_000077317.1.82862 WP_000077317.1.8289 WP_000077317.1.82976 WP_000077317.1.82980 WP_000077317.1.83152 WP_000077317.1.83153 WP_000077317.1.83185 WP_000077317.1.83193 WP_000077317.1.83234 WP_000077317.1.8328 WP_000077317.1.83316 WP_000077317.1.83352 WP_000077317.1.83372 WP_000077317.1.83418 WP_000077317.1.83476 WP_000077317.1.83484 WP_000077317.1.83508 WP_000077317.1.83517 WP_000077317.1.83593 WP_000077317.1.83646 WP_000077317.1.83653 WP_000077317.1.83676 WP_000077317.1.83720 WP_000077317.1.83763 WP_000077317.1.83769 WP_000077317.1.83804 WP_000077317.1.83825 WP_000077317.1.8383 WP_000077317.1.83864 WP_000077317.1.83865 WP_000077317.1.83881 WP_000077317.1.83905 WP_000077317.1.83912 WP_000077317.1.83919 WP_000077317.1.83928 WP_000077317.1.83955 WP_000077317.1.83984 WP_000077317.1.84049 WP_000077317.1.84144 WP_000077317.1.84163 WP_000077317.1.84342 WP_000077317.1.84442 WP_000077317.1.84445 WP_000077317.1.84451 WP_000077317.1.84508 WP_000077317.1.84509 WP_000077317.1.84563 WP_000077317.1.84578 WP_000077317.1.84625 WP_000077317.1.84638 WP_000077317.1.8468 WP_000077317.1.84682 WP_000077317.1.8475 WP_000077317.1.84752 WP_000077317.1.84757 WP_000077317.1.84761 WP_000077317.1.84815 WP_000077317.1.84889 WP_000077317.1.84903 WP_000077317.1.84907 WP_000077317.1.84922 WP_000077317.1.8493 WP_000077317.1.85022 WP_000077317.1.85047 WP_000077317.1.85056 WP_000077317.1.85081 WP_000077317.1.85099 WP_000077317.1.85132 WP_000077317.1.85135 WP_000077317.1.85144 WP_000077317.1.85151 WP_000077317.1.85213 WP_000077317.1.85226 WP_000077317.1.85238 WP_000077317.1.85302 WP_000077317.1.85351 WP_000077317.1.85383 WP_000077317.1.85395 WP_000077317.1.85404 WP_000077317.1.85445 WP_000077317.1.85471 WP_000077317.1.85474 WP_000077317.1.85492 WP_000077317.1.85506 WP_000077317.1.85515 WP_000077317.1.85519 WP_000077317.1.85547 WP_000077317.1.85586 WP_000077317.1.85596 WP_000077317.1.85649 WP_000077317.1.85758 WP_000077317.1.85795 WP_000077317.1.85796 WP_000077317.1.85816 WP_000077317.1.85834 WP_000077317.1.85873 WP_000077317.1.85927 WP_000077317.1.85950 WP_000077317.1.85989 WP_000077317.1.85993 WP_000077317.1.86018 WP_000077317.1.86072 WP_000077317.1.86144 WP_000077317.1.86154 WP_000077317.1.86158 WP_000077317.1.8617 WP_000077317.1.86188 WP_000077317.1.86207 WP_000077317.1.86248 WP_000077317.1.8627 WP_000077317.1.86270 WP_000077317.1.86304 WP_000077317.1.86344 WP_000077317.1.86367 WP_000077317.1.86378 WP_000077317.1.8643 WP_000077317.1.86439 WP_000077317.1.86482 WP_000077317.1.86523 WP_000077317.1.86542 WP_000077317.1.86628 WP_000077317.1.86706 WP_000077317.1.86792 WP_000077317.1.8681 WP_000077317.1.86838 WP_000077317.1.86911 WP_000077317.1.86940 WP_000077317.1.86961 WP_000077317.1.86977 WP_000077317.1.87021 WP_000077317.1.87042 WP_000077317.1.87057 WP_000077317.1.87072 WP_000077317.1.87090 WP_000077317.1.87119 WP_000077317.1.87122 WP_000077317.1.87141 WP_000077317.1.87175 WP_000077317.1.87194 WP_000077317.1.8720 WP_000077317.1.87260 WP_000077317.1.87261 WP_000077317.1.87285 WP_000077317.1.87290 WP_000077317.1.8731 WP_000077317.1.87396 WP_000077317.1.87457 WP_000077317.1.87461 WP_000077317.1.87466 WP_000077317.1.875 WP_000077317.1.87508 WP_000077317.1.87515 WP_000077317.1.8753 WP_000077317.1.87543 WP_000077317.1.87710 WP_000077317.1.87718 WP_000077317.1.87748 WP_000077317.1.87764 WP_000077317.1.8779 WP_000077317.1.87828 WP_000077317.1.87838 WP_000077317.1.87879 WP_000077317.1.8791 WP_000077317.1.87912 WP_000077317.1.87963 WP_000077317.1.87964 WP_000077317.1.87972 WP_000077317.1.87995 WP_000077317.1.88013 WP_000077317.1.88032 WP_000077317.1.88061 WP_000077317.1.88114 WP_000077317.1.88150 WP_000077317.1.88270 WP_000077317.1.88317 WP_000077317.1.88319 WP_000077317.1.88367 WP_000077317.1.88371 WP_000077317.1.88373 WP_000077317.1.88380 WP_000077317.1.88480 WP_000077317.1.88498 WP_000077317.1.88518 WP_000077317.1.88555 WP_000077317.1.88558 WP_000077317.1.8857 WP_000077317.1.88580 WP_000077317.1.88599 WP_000077317.1.88623 WP_000077317.1.88636 WP_000077317.1.88642 WP_000077317.1.88671 WP_000077317.1.88694 WP_000077317.1.8872 WP_000077317.1.88739 WP_000077317.1.88856 WP_000077317.1.88859 WP_000077317.1.8886 WP_000077317.1.8888 WP_000077317.1.88897 WP_000077317.1.88922 WP_000077317.1.88934 WP_000077317.1.8900 WP_000077317.1.89086 WP_000077317.1.8913 WP_000077317.1.89133 WP_000077317.1.89181 WP_000077317.1.89194 WP_000077317.1.89195 WP_000077317.1.89204 WP_000077317.1.8924 WP_000077317.1.89258 WP_000077317.1.89284 WP_000077317.1.89516 WP_000077317.1.89537 WP_000077317.1.89544 WP_000077317.1.89559 WP_000077317.1.89655 WP_000077317.1.89672 WP_000077317.1.89678 WP_000077317.1.897 WP_000077317.1.89726 WP_000077317.1.89730 WP_000077317.1.89754 WP_000077317.1.89883 WP_000077317.1.89935 WP_000077317.1.89960 WP_000077317.1.90005 WP_000077317.1.90018 WP_000077317.1.90038 WP_000077317.1.90046 WP_000077317.1.90055 WP_000077317.1.90091 WP_000077317.1.90131 WP_000077317.1.90148 WP_000077317.1.90161 WP_000077317.1.90180 WP_000077317.1.90215 WP_000077317.1.9022 WP_000077317.1.90243 WP_000077317.1.90253 WP_000077317.1.90276 WP_000077317.1.9030 WP_000077317.1.90331 WP_000077317.1.90367 WP_000077317.1.90473 WP_000077317.1.90544 WP_000077317.1.90554 WP_000077317.1.90604 WP_000077317.1.90647 WP_000077317.1.90660 WP_000077317.1.90683 WP_000077317.1.90726 WP_000077317.1.90728 WP_000077317.1.90738 WP_000077317.1.90745 WP_000077317.1.90801 WP_000077317.1.90804 WP_000077317.1.90861 WP_000077317.1.90896 WP_000077317.1.90903 WP_000077317.1.9100 WP_000077317.1.91011 WP_000077317.1.91054 WP_000077317.1.91126 WP_000077317.1.9114 WP_000077317.1.91158 WP_000077317.1.91177 WP_000077317.1.912 WP_000077317.1.91233 WP_000077317.1.91246 WP_000077317.1.91258 WP_000077317.1.91279 WP_000077317.1.91300 WP_000077317.1.91332 WP_000077317.1.91346 WP_000077317.1.91357 WP_000077317.1.91364 WP_000077317.1.91382 WP_000077317.1.9140 WP_000077317.1.91420 WP_000077317.1.91427 WP_000077317.1.91487 WP_000077317.1.91500 WP_000077317.1.91559 WP_000077317.1.91573 WP_000077317.1.91581 WP_000077317.1.91587 WP_000077317.1.91639 WP_000077317.1.91749 WP_000077317.1.91771 WP_000077317.1.91791 WP_000077317.1.91800 WP_000077317.1.91816 WP_000077317.1.91829 WP_000077317.1.91895 WP_000077317.1.91928 WP_000077317.1.91950 WP_000077317.1.92 WP_000077317.1.92080 WP_000077317.1.92133 WP_000077317.1.92140 WP_000077317.1.92143 WP_000077317.1.92164 WP_000077317.1.92169 WP_000077317.1.92173 WP_000077317.1.92185 WP_000077317.1.92196 WP_000077317.1.92227 WP_000077317.1.9224 WP_000077317.1.92253 WP_000077317.1.92254 WP_000077317.1.92297 WP_000077317.1.923 WP_000077317.1.9234 WP_000077317.1.9239 WP_000077317.1.92436 WP_000077317.1.92442 WP_000077317.1.92488 WP_000077317.1.92497 WP_000077317.1.92500 WP_000077317.1.92520 WP_000077317.1.92534 WP_000077317.1.92565 WP_000077317.1.92607 WP_000077317.1.92691 WP_000077317.1.92723 WP_000077317.1.92735 WP_000077317.1.92741 WP_000077317.1.92773 WP_000077317.1.92789 WP_000077317.1.92805 WP_000077317.1.92862 WP_000077317.1.92864 WP_000077317.1.9293 WP_000077317.1.92950 WP_000077317.1.93074 WP_000077317.1.93125 WP_000077317.1.93163 WP_000077317.1.93176 WP_000077317.1.93191 WP_000077317.1.93211 WP_000077317.1.93224 WP_000077317.1.93296 WP_000077317.1.93300 WP_000077317.1.93336 WP_000077317.1.93416 WP_000077317.1.93438 WP_000077317.1.93444 WP_000077317.1.93514 WP_000077317.1.9352 WP_000077317.1.9354 WP_000077317.1.9358 WP_000077317.1.93590 WP_000077317.1.93658 WP_000077317.1.93678 WP_000077317.1.93710 WP_000077317.1.93722 WP_000077317.1.93738 WP_000077317.1.93769 WP_000077317.1.93787 WP_000077317.1.9387 WP_000077317.1.93882 WP_000077317.1.93883 WP_000077317.1.93891 WP_000077317.1.93976 WP_000077317.1.9398 WP_000077317.1.93981 WP_000077317.1.94074 WP_000077317.1.94082 WP_000077317.1.94087 WP_000077317.1.94096 WP_000077317.1.9411 WP_000077317.1.94119 WP_000077317.1.94165 WP_000077317.1.94172 WP_000077317.1.94293 WP_000077317.1.94294 WP_000077317.1.94335 WP_000077317.1.94340 WP_000077317.1.9437 WP_000077317.1.94374 WP_000077317.1.94375 WP_000077317.1.94389 WP_000077317.1.94414 WP_000077317.1.94530 WP_000077317.1.94550 WP_000077317.1.94576 WP_000077317.1.94688 WP_000077317.1.94733 WP_000077317.1.94741 WP_000077317.1.94789 WP_000077317.1.94797 WP_000077317.1.94844 WP_000077317.1.94845 WP_000077317.1.94857 WP_000077317.1.94866 WP_000077317.1.9497 WP_000077317.1.94980 WP_000077317.1.94989 WP_000077317.1.94999 WP_000077317.1.95038 WP_000077317.1.95075 WP_000077317.1.95077 WP_000077317.1.9510 WP_000077317.1.95120 WP_000077317.1.95318 WP_000077317.1.95327 WP_000077317.1.95342 WP_000077317.1.95361 WP_000077317.1.95372 WP_000077317.1.9538 WP_000077317.1.95476 WP_000077317.1.95537 WP_000077317.1.95550 WP_000077317.1.95571 WP_000077317.1.95581 WP_000077317.1.95603 WP_000077317.1.95639 WP_000077317.1.95681 WP_000077317.1.95699 WP_000077317.1.95704 WP_000077317.1.95713 WP_000077317.1.95714 WP_000077317.1.95737 WP_000077317.1.95806 WP_000077317.1.95877 WP_000077317.1.95885 WP_000077317.1.95914 WP_000077317.1.95918 WP_000077317.1.95986 WP_000077317.1.95997 WP_000077317.1.96014 WP_000077317.1.96022 WP_000077317.1.96030 WP_000077317.1.96056 WP_000077317.1.96057 WP_000077317.1.96067 WP_000077317.1.96075 WP_000077317.1.96135 WP_000077317.1.96148 WP_000077317.1.9617 WP_000077317.1.96228 WP_000077317.1.96255 WP_000077317.1.96283 WP_000077317.1.96297 WP_000077317.1.96312 WP_000077317.1.96314 WP_000077317.1.96322 WP_000077317.1.96334 WP_000077317.1.96362 WP_000077317.1.96433 WP_000077317.1.96472 WP_000077317.1.96474 WP_000077317.1.9650 WP_000077317.1.96535 WP_000077317.1.96538 WP_000077317.1.96554 WP_000077317.1.96566 WP_000077317.1.96591 WP_000077317.1.96634 WP_000077317.1.96678 WP_000077317.1.96699 WP_000077317.1.96705 WP_000077317.1.9675 WP_000077317.1.96780 WP_000077317.1.96836 WP_000077317.1.96855 WP_000077317.1.96859 WP_000077317.1.96922 WP_000077317.1.96965 WP_000077317.1.96969 WP_000077317.1.96985 WP_000077317.1.96997 WP_000077317.1.97000 WP_000077317.1.97004 WP_000077317.1.97014 WP_000077317.1.97029 WP_000077317.1.97034 WP_000077317.1.97161 WP_000077317.1.97164 WP_000077317.1.97205 WP_000077317.1.97228 WP_000077317.1.97230 WP_000077317.1.97241 WP_000077317.1.97312 WP_000077317.1.97336 WP_000077317.1.97348 WP_000077317.1.97352 WP_000077317.1.97355 WP_000077317.1.97367 WP_000077317.1.9737 WP_000077317.1.97392 WP_000077317.1.97427 WP_000077317.1.97450 WP_000077317.1.97456 WP_000077317.1.97468 WP_000077317.1.97494 WP_000077317.1.97530 WP_000077317.1.97531 WP_000077317.1.97537 WP_000077317.1.97576 WP_000077317.1.97585 WP_000077317.1.97664 WP_000077317.1.97687 WP_000077317.1.97696 WP_000077317.1.97699 WP_000077317.1.97720 WP_000077317.1.97729 WP_000077317.1.97744 WP_000077317.1.97746 WP_000077317.1.97762 WP_000077317.1.97935 WP_000077317.1.97955 WP_000077317.1.97967 WP_000077317.1.97974 WP_000077317.1.97997 WP_000077317.1.98054 WP_000077317.1.98058 WP_000077317.1.98073 WP_000077317.1.98161 WP_000077317.1.98174 WP_000077317.1.98179 WP_000077317.1.98195 WP_000077317.1.98233 WP_000077317.1.98248 WP_000077317.1.98249 WP_000077317.1.98281 WP_000077317.1.98295 WP_000077317.1.98328 WP_000077317.1.98352 WP_000077317.1.98353 WP_000077317.1.98366 WP_000077317.1.98387 WP_000077317.1.98409 WP_000077317.1.98425 WP_000077317.1.98585 WP_000077317.1.98609 WP_000077317.1.98659 WP_000077317.1.98667 WP_000077317.1.9872 WP_000077317.1.98723 WP_000077317.1.98730 WP_000077317.1.98734 WP_000077317.1.98741 WP_000077317.1.98750 WP_000077317.1.98786 WP_000077317.1.98797 WP_000077317.1.98821 WP_000077317.1.98842 WP_000077317.1.98880 WP_000077317.1.98883 WP_000077317.1.98894 WP_000077317.1.98978 WP_000077317.1.98985 WP_000077317.1.9910 WP_000077317.1.9912 WP_000077317.1.99136 WP_000077317.1.99207 WP_000077317.1.99217 WP_000077317.1.99283 WP_000077317.1.99308 WP_000077317.1.99414 WP_000077317.1.99418 WP_000077317.1.99509 WP_000077317.1.99523 WP_000077317.1.9965 WP_000077317.1.99683 WP_000077317.1.99830 WP_000077317.1.99849 WP_000077317.1.99859 WP_000077317.1.99884 WP_000077317.1.99954 WP_000077317.1.99955 WP_000077317.1.99984 WP_000077317.1.99999 gi|384863712|ref|YP_005749071.1| gi|387149540|ref|YP_005741104.1| gi|537460098|ref|YP_008490538.1| gi|156978685|ref|YP_001440944.1| gi|148266844|ref|YP_001245787.1| gi|269202005|ref|YP_003281274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]