SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150394055|ref|YP_001316730.1| from Staphylococcus aureus subsp. aureus JH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150394055|ref|YP_001316730.1|
Domain Number 1 Region: 139-290
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000000785
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.023
Further Details:      
 
Domain Number 2 Region: 14-63
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000188
Family AraC type transcriptional activator 0.016
Further Details:      
 
Weak hits

Sequence:  gi|150394055|ref|YP_001316730.1|
Domain Number - Region: 67-112
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00108
Family AraC type transcriptional activator 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150394055|ref|YP_001316730.1|
Sequence length 297
Comment transcription activator effector binding [Staphylococcus aureus subsp. aureus JH1]
Sequence
MIELIGVKVLDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGLSPE
AYARARKMTLAANDVINGATRLVDIAKKYHYANSNDFANDFSDFHGVSPIQASTKKDELQ
IQERLYIKLSTTERAPYPYRLEETDDISLVGYARFIDTKYLSHPFNVPDFLEDLLIDGKI
KELRRYNDVSPFELFVISCPLENGLEIFVGVPSERYPAHLESRFLPGKHCAKFNLQGEID
YATNEAWYYIESSLQLTLPYERNDLYVEVYPLDISFNDPFTKIQLWIPVKQSPYDED
Download sequence
Identical sequences A0A0D1JL85 A0A0E0VPA9 A0A0E1VJC3 A0A0E1X559 A0A0H2I3D5 A0A0H2WWU1 A0A0H2XJB0 A0A0H3K897 A0A1E8X302 A0A2H5ANZ8 Q2FY65 T1Y8K5
gi|470222840|ref|YP_007621397.1| gi|386729207|ref|YP_006195590.1| gi|150394055|ref|YP_001316730.1| gi|148267990|ref|YP_001246933.1| gi|87162397|ref|YP_494151.1| gi|470224807|ref|YP_007623386.1| gi|57650462|ref|YP_186391.1| gi|384547741|ref|YP_005736994.1| gi|470193351|ref|YP_007579704.1| gi|470197282|ref|YP_007583683.1| gi|384867521|ref|YP_005747717.1| WP_000571108.1.100013 WP_000571108.1.100041 WP_000571108.1.100049 WP_000571108.1.100057 WP_000571108.1.100067 WP_000571108.1.100072 WP_000571108.1.100075 WP_000571108.1.100088 WP_000571108.1.100090 WP_000571108.1.100094 WP_000571108.1.100096 WP_000571108.1.100122 WP_000571108.1.10014 WP_000571108.1.100154 WP_000571108.1.100171 WP_000571108.1.100180 WP_000571108.1.100184 WP_000571108.1.100189 WP_000571108.1.100235 WP_000571108.1.100265 WP_000571108.1.100272 WP_000571108.1.100298 WP_000571108.1.100307 WP_000571108.1.100310 WP_000571108.1.10032 WP_000571108.1.100347 WP_000571108.1.100352 WP_000571108.1.100357 WP_000571108.1.100366 WP_000571108.1.100384 WP_000571108.1.100391 WP_000571108.1.100399 WP_000571108.1.10041 WP_000571108.1.100452 WP_000571108.1.10046 WP_000571108.1.100464 WP_000571108.1.10050 WP_000571108.1.100507 WP_000571108.1.100527 WP_000571108.1.10053 WP_000571108.1.100534 WP_000571108.1.100535 WP_000571108.1.100551 WP_000571108.1.100560 WP_000571108.1.100562 WP_000571108.1.100582 WP_000571108.1.100596 WP_000571108.1.100604 WP_000571108.1.100612 WP_000571108.1.100613 WP_000571108.1.100618 WP_000571108.1.100631 WP_000571108.1.100647 WP_000571108.1.100668 WP_000571108.1.100678 WP_000571108.1.100693 WP_000571108.1.100699 WP_000571108.1.100704 WP_000571108.1.100719 WP_000571108.1.100726 WP_000571108.1.100761 WP_000571108.1.100768 WP_000571108.1.100785 WP_000571108.1.100823 WP_000571108.1.100832 WP_000571108.1.100834 WP_000571108.1.100860 WP_000571108.1.100888 WP_000571108.1.1009 WP_000571108.1.100903 WP_000571108.1.100920 WP_000571108.1.100922 WP_000571108.1.100934 WP_000571108.1.100956 WP_000571108.1.100963 WP_000571108.1.10097 WP_000571108.1.100981 WP_000571108.1.100986 WP_000571108.1.100987 WP_000571108.1.101002 WP_000571108.1.101017 WP_000571108.1.101019 WP_000571108.1.101023 WP_000571108.1.101027 WP_000571108.1.101055 WP_000571108.1.101068 WP_000571108.1.101071 WP_000571108.1.101072 WP_000571108.1.101084 WP_000571108.1.101103 WP_000571108.1.10111 WP_000571108.1.101142 WP_000571108.1.101160 WP_000571108.1.101177 WP_000571108.1.101192 WP_000571108.1.101217 WP_000571108.1.101240 WP_000571108.1.101262 WP_000571108.1.101266 WP_000571108.1.101327 WP_000571108.1.101352 WP_000571108.1.101355 WP_000571108.1.101375 WP_000571108.1.101379 WP_000571108.1.101393 WP_000571108.1.101402 WP_000571108.1.101414 WP_000571108.1.101440 WP_000571108.1.101441 WP_000571108.1.101458 WP_000571108.1.10148 WP_000571108.1.101490 WP_000571108.1.101495 WP_000571108.1.1015 WP_000571108.1.101505 WP_000571108.1.101531 WP_000571108.1.101566 WP_000571108.1.101567 WP_000571108.1.101570 WP_000571108.1.101615 WP_000571108.1.101627 WP_000571108.1.101645 WP_000571108.1.10165 WP_000571108.1.101657 WP_000571108.1.10166 WP_000571108.1.101661 WP_000571108.1.101670 WP_000571108.1.101691 WP_000571108.1.101704 WP_000571108.1.101716 WP_000571108.1.101725 WP_000571108.1.101728 WP_000571108.1.101731 WP_000571108.1.101745 WP_000571108.1.101757 WP_000571108.1.101758 WP_000571108.1.101775 WP_000571108.1.101778 WP_000571108.1.101779 WP_000571108.1.101788 WP_000571108.1.101813 WP_000571108.1.101820 WP_000571108.1.101821 WP_000571108.1.101824 WP_000571108.1.101825 WP_000571108.1.101831 WP_000571108.1.101852 WP_000571108.1.101902 WP_000571108.1.101906 WP_000571108.1.101921 WP_000571108.1.101922 WP_000571108.1.101943 WP_000571108.1.101950 WP_000571108.1.101999 WP_000571108.1.102065 WP_000571108.1.102070 WP_000571108.1.102084 WP_000571108.1.10209 WP_000571108.1.102096 WP_000571108.1.102123 WP_000571108.1.102126 WP_000571108.1.102130 WP_000571108.1.102132 WP_000571108.1.10214 WP_000571108.1.1022 WP_000571108.1.10232 WP_000571108.1.10238 WP_000571108.1.10240 WP_000571108.1.10244 WP_000571108.1.10249 WP_000571108.1.1025 WP_000571108.1.10274 WP_000571108.1.10292 WP_000571108.1.10294 WP_000571108.1.10301 WP_000571108.1.10306 WP_000571108.1.10308 WP_000571108.1.1031 WP_000571108.1.1032 WP_000571108.1.10321 WP_000571108.1.10343 WP_000571108.1.10355 WP_000571108.1.10358 WP_000571108.1.10397 WP_000571108.1.10408 WP_000571108.1.1043 WP_000571108.1.10431 WP_000571108.1.10436 WP_000571108.1.10450 WP_000571108.1.10469 WP_000571108.1.10478 WP_000571108.1.10481 WP_000571108.1.10486 WP_000571108.1.10503 WP_000571108.1.1052 WP_000571108.1.10526 WP_000571108.1.10542 WP_000571108.1.10543 WP_000571108.1.10565 WP_000571108.1.1060 WP_000571108.1.10614 WP_000571108.1.10617 WP_000571108.1.10624 WP_000571108.1.10664 WP_000571108.1.10679 WP_000571108.1.10707 WP_000571108.1.10726 WP_000571108.1.10742 WP_000571108.1.10749 WP_000571108.1.10751 WP_000571108.1.1077 WP_000571108.1.10783 WP_000571108.1.10785 WP_000571108.1.10823 WP_000571108.1.10843 WP_000571108.1.10858 WP_000571108.1.1087 WP_000571108.1.10917 WP_000571108.1.10919 WP_000571108.1.10928 WP_000571108.1.10942 WP_000571108.1.10950 WP_000571108.1.10965 WP_000571108.1.10969 WP_000571108.1.10976 WP_000571108.1.10986 WP_000571108.1.11001 WP_000571108.1.11069 WP_000571108.1.11073 WP_000571108.1.11074 WP_000571108.1.11076 WP_000571108.1.11083 WP_000571108.1.11084 WP_000571108.1.11129 WP_000571108.1.1115 WP_000571108.1.11162 WP_000571108.1.11184 WP_000571108.1.11188 WP_000571108.1.1120 WP_000571108.1.11202 WP_000571108.1.11220 WP_000571108.1.11223 WP_000571108.1.11234 WP_000571108.1.1124 WP_000571108.1.11261 WP_000571108.1.11281 WP_000571108.1.11282 WP_000571108.1.11286 WP_000571108.1.11287 WP_000571108.1.11294 WP_000571108.1.11312 WP_000571108.1.11322 WP_000571108.1.11333 WP_000571108.1.11348 WP_000571108.1.11353 WP_000571108.1.1136 WP_000571108.1.11365 WP_000571108.1.11377 WP_000571108.1.11378 WP_000571108.1.11391 WP_000571108.1.11403 WP_000571108.1.11407 WP_000571108.1.11434 WP_000571108.1.11441 WP_000571108.1.11447 WP_000571108.1.11451 WP_000571108.1.11463 WP_000571108.1.1147 WP_000571108.1.11475 WP_000571108.1.11488 WP_000571108.1.11492 WP_000571108.1.11494 WP_000571108.1.11504 WP_000571108.1.1151 WP_000571108.1.11513 WP_000571108.1.1152 WP_000571108.1.11525 WP_000571108.1.11540 WP_000571108.1.11556 WP_000571108.1.11558 WP_000571108.1.11571 WP_000571108.1.11580 WP_000571108.1.11592 WP_000571108.1.11611 WP_000571108.1.11640 WP_000571108.1.11646 WP_000571108.1.11655 WP_000571108.1.11660 WP_000571108.1.11663 WP_000571108.1.11665 WP_000571108.1.11692 WP_000571108.1.117 WP_000571108.1.1171 WP_000571108.1.11719 WP_000571108.1.11720 WP_000571108.1.11723 WP_000571108.1.11730 WP_000571108.1.11736 WP_000571108.1.11741 WP_000571108.1.11768 WP_000571108.1.11781 WP_000571108.1.11794 WP_000571108.1.11795 WP_000571108.1.11829 WP_000571108.1.11837 WP_000571108.1.11884 WP_000571108.1.11894 WP_000571108.1.11903 WP_000571108.1.11904 WP_000571108.1.11919 WP_000571108.1.11969 WP_000571108.1.11991 WP_000571108.1.12019 WP_000571108.1.12026 WP_000571108.1.12029 WP_000571108.1.1205 WP_000571108.1.12073 WP_000571108.1.12098 WP_000571108.1.1210 WP_000571108.1.12123 WP_000571108.1.1213 WP_000571108.1.12137 WP_000571108.1.12149 WP_000571108.1.12152 WP_000571108.1.12158 WP_000571108.1.12170 WP_000571108.1.12175 WP_000571108.1.12179 WP_000571108.1.12181 WP_000571108.1.12193 WP_000571108.1.12201 WP_000571108.1.12226 WP_000571108.1.12233 WP_000571108.1.12234 WP_000571108.1.12256 WP_000571108.1.12272 WP_000571108.1.12297 WP_000571108.1.12328 WP_000571108.1.12330 WP_000571108.1.12437 WP_000571108.1.12447 WP_000571108.1.12498 WP_000571108.1.12508 WP_000571108.1.12516 WP_000571108.1.1253 WP_000571108.1.12555 WP_000571108.1.1257 WP_000571108.1.12597 WP_000571108.1.12598 WP_000571108.1.12605 WP_000571108.1.12608 WP_000571108.1.12618 WP_000571108.1.12639 WP_000571108.1.12668 WP_000571108.1.12685 WP_000571108.1.12705 WP_000571108.1.12707 WP_000571108.1.12711 WP_000571108.1.12715 WP_000571108.1.12733 WP_000571108.1.12737 WP_000571108.1.1276 WP_000571108.1.12770 WP_000571108.1.12771 WP_000571108.1.12772 WP_000571108.1.12780 WP_000571108.1.12788 WP_000571108.1.12802 WP_000571108.1.12822 WP_000571108.1.12829 WP_000571108.1.12833 WP_000571108.1.12845 WP_000571108.1.12858 WP_000571108.1.12862 WP_000571108.1.12884 WP_000571108.1.12886 WP_000571108.1.12903 WP_000571108.1.12904 WP_000571108.1.12918 WP_000571108.1.12920 WP_000571108.1.12937 WP_000571108.1.12938 WP_000571108.1.12951 WP_000571108.1.12977 WP_000571108.1.13013 WP_000571108.1.13039 WP_000571108.1.13062 WP_000571108.1.13072 WP_000571108.1.13091 WP_000571108.1.13104 WP_000571108.1.13112 WP_000571108.1.13154 WP_000571108.1.13169 WP_000571108.1.13170 WP_000571108.1.13189 WP_000571108.1.13228 WP_000571108.1.13243 WP_000571108.1.13250 WP_000571108.1.13303 WP_000571108.1.13307 WP_000571108.1.13317 WP_000571108.1.13322 WP_000571108.1.13326 WP_000571108.1.13336 WP_000571108.1.13355 WP_000571108.1.13366 WP_000571108.1.13376 WP_000571108.1.13379 WP_000571108.1.13405 WP_000571108.1.13448 WP_000571108.1.13468 WP_000571108.1.1347 WP_000571108.1.13486 WP_000571108.1.13501 WP_000571108.1.13505 WP_000571108.1.13514 WP_000571108.1.13531 WP_000571108.1.13532 WP_000571108.1.1355 WP_000571108.1.13554 WP_000571108.1.13556 WP_000571108.1.13557 WP_000571108.1.13568 WP_000571108.1.13612 WP_000571108.1.13617 WP_000571108.1.13650 WP_000571108.1.13654 WP_000571108.1.13665 WP_000571108.1.13668 WP_000571108.1.13670 WP_000571108.1.13679 WP_000571108.1.13683 WP_000571108.1.13696 WP_000571108.1.13709 WP_000571108.1.13726 WP_000571108.1.13727 WP_000571108.1.13728 WP_000571108.1.13733 WP_000571108.1.13734 WP_000571108.1.1374 WP_000571108.1.1375 WP_000571108.1.13755 WP_000571108.1.13757 WP_000571108.1.13769 WP_000571108.1.13772 WP_000571108.1.13804 WP_000571108.1.13805 WP_000571108.1.13807 WP_000571108.1.13831 WP_000571108.1.13870 WP_000571108.1.13879 WP_000571108.1.13884 WP_000571108.1.13897 WP_000571108.1.13904 WP_000571108.1.13914 WP_000571108.1.13933 WP_000571108.1.13940 WP_000571108.1.13947 WP_000571108.1.13948 WP_000571108.1.13983 WP_000571108.1.13986 WP_000571108.1.13987 WP_000571108.1.14010 WP_000571108.1.14025 WP_000571108.1.14034 WP_000571108.1.14071 WP_000571108.1.14076 WP_000571108.1.14097 WP_000571108.1.14112 WP_000571108.1.14143 WP_000571108.1.14153 WP_000571108.1.14163 WP_000571108.1.1418 WP_000571108.1.14192 WP_000571108.1.1420 WP_000571108.1.14201 WP_000571108.1.14221 WP_000571108.1.14233 WP_000571108.1.1425 WP_000571108.1.1426 WP_000571108.1.14272 WP_000571108.1.1429 WP_000571108.1.14298 WP_000571108.1.14302 WP_000571108.1.14305 WP_000571108.1.14314 WP_000571108.1.14337 WP_000571108.1.14342 WP_000571108.1.14349 WP_000571108.1.14355 WP_000571108.1.14358 WP_000571108.1.14363 WP_000571108.1.14364 WP_000571108.1.14365 WP_000571108.1.14366 WP_000571108.1.14372 WP_000571108.1.14394 WP_000571108.1.14397 WP_000571108.1.14412 WP_000571108.1.14418 WP_000571108.1.14475 WP_000571108.1.14535 WP_000571108.1.14546 WP_000571108.1.14577 WP_000571108.1.14590 WP_000571108.1.14639 WP_000571108.1.14665 WP_000571108.1.14681 WP_000571108.1.14696 WP_000571108.1.147 WP_000571108.1.1471 WP_000571108.1.14729 WP_000571108.1.14734 WP_000571108.1.14744 WP_000571108.1.14747 WP_000571108.1.1477 WP_000571108.1.14770 WP_000571108.1.14774 WP_000571108.1.14782 WP_000571108.1.14787 WP_000571108.1.14790 WP_000571108.1.14809 WP_000571108.1.14823 WP_000571108.1.14825 WP_000571108.1.14846 WP_000571108.1.14866 WP_000571108.1.14868 WP_000571108.1.14869 WP_000571108.1.14874 WP_000571108.1.14888 WP_000571108.1.1490 WP_000571108.1.14902 WP_000571108.1.14924 WP_000571108.1.14967 WP_000571108.1.14970 WP_000571108.1.14987 WP_000571108.1.15000 WP_000571108.1.15015 WP_000571108.1.15022 WP_000571108.1.15029 WP_000571108.1.15039 WP_000571108.1.15071 WP_000571108.1.15091 WP_000571108.1.15098 WP_000571108.1.15150 WP_000571108.1.15173 WP_000571108.1.15182 WP_000571108.1.15185 WP_000571108.1.1520 WP_000571108.1.15201 WP_000571108.1.15206 WP_000571108.1.15228 WP_000571108.1.15234 WP_000571108.1.1525 WP_000571108.1.15255 WP_000571108.1.15263 WP_000571108.1.15269 WP_000571108.1.15278 WP_000571108.1.15294 WP_000571108.1.15296 WP_000571108.1.15329 WP_000571108.1.15399 WP_000571108.1.15403 WP_000571108.1.15409 WP_000571108.1.15421 WP_000571108.1.15438 WP_000571108.1.1545 WP_000571108.1.15489 WP_000571108.1.15505 WP_000571108.1.15507 WP_000571108.1.15519 WP_000571108.1.15524 WP_000571108.1.15532 WP_000571108.1.15533 WP_000571108.1.15544 WP_000571108.1.15546 WP_000571108.1.15554 WP_000571108.1.15572 WP_000571108.1.1558 WP_000571108.1.15590 WP_000571108.1.15591 WP_000571108.1.15601 WP_000571108.1.1562 WP_000571108.1.1564 WP_000571108.1.15641 WP_000571108.1.15679 WP_000571108.1.15687 WP_000571108.1.1569 WP_000571108.1.15691 WP_000571108.1.15706 WP_000571108.1.15712 WP_000571108.1.15722 WP_000571108.1.15785 WP_000571108.1.1579 WP_000571108.1.15812 WP_000571108.1.15818 WP_000571108.1.15819 WP_000571108.1.1583 WP_000571108.1.15838 WP_000571108.1.1586 WP_000571108.1.15883 WP_000571108.1.15888 WP_000571108.1.15892 WP_000571108.1.15897 WP_000571108.1.15898 WP_000571108.1.159 WP_000571108.1.15920 WP_000571108.1.15921 WP_000571108.1.15925 WP_000571108.1.15928 WP_000571108.1.15948 WP_000571108.1.15957 WP_000571108.1.15972 WP_000571108.1.1599 WP_000571108.1.1600 WP_000571108.1.16018 WP_000571108.1.16026 WP_000571108.1.1606 WP_000571108.1.16068 WP_000571108.1.16083 WP_000571108.1.16095 WP_000571108.1.16096 WP_000571108.1.16098 WP_000571108.1.16112 WP_000571108.1.16114 WP_000571108.1.16140 WP_000571108.1.16157 WP_000571108.1.16173 WP_000571108.1.16195 WP_000571108.1.16203 WP_000571108.1.16213 WP_000571108.1.16214 WP_000571108.1.16223 WP_000571108.1.1623 WP_000571108.1.16237 WP_000571108.1.16251 WP_000571108.1.16265 WP_000571108.1.16276 WP_000571108.1.16283 WP_000571108.1.16311 WP_000571108.1.16362 WP_000571108.1.16372 WP_000571108.1.16395 WP_000571108.1.16399 WP_000571108.1.16407 WP_000571108.1.16408 WP_000571108.1.16414 WP_000571108.1.16417 WP_000571108.1.16433 WP_000571108.1.16436 WP_000571108.1.16458 WP_000571108.1.16478 WP_000571108.1.16554 WP_000571108.1.16564 WP_000571108.1.16569 WP_000571108.1.16589 WP_000571108.1.16603 WP_000571108.1.16606 WP_000571108.1.16617 WP_000571108.1.1662 WP_000571108.1.16628 WP_000571108.1.16632 WP_000571108.1.16639 WP_000571108.1.16649 WP_000571108.1.1665 WP_000571108.1.16651 WP_000571108.1.16653 WP_000571108.1.1666 WP_000571108.1.16664 WP_000571108.1.16672 WP_000571108.1.16684 WP_000571108.1.16688 WP_000571108.1.16693 WP_000571108.1.16703 WP_000571108.1.16747 WP_000571108.1.16757 WP_000571108.1.16761 WP_000571108.1.16762 WP_000571108.1.16768 WP_000571108.1.16770 WP_000571108.1.16776 WP_000571108.1.16794 WP_000571108.1.16802 WP_000571108.1.16815 WP_000571108.1.16824 WP_000571108.1.16833 WP_000571108.1.16880 WP_000571108.1.16882 WP_000571108.1.16892 WP_000571108.1.16920 WP_000571108.1.16925 WP_000571108.1.16936 WP_000571108.1.16938 WP_000571108.1.16946 WP_000571108.1.16969 WP_000571108.1.17009 WP_000571108.1.17038 WP_000571108.1.17046 WP_000571108.1.17080 WP_000571108.1.17104 WP_000571108.1.17122 WP_000571108.1.17132 WP_000571108.1.17137 WP_000571108.1.17139 WP_000571108.1.17143 WP_000571108.1.17157 WP_000571108.1.17169 WP_000571108.1.17176 WP_000571108.1.17180 WP_000571108.1.17193 WP_000571108.1.17200 WP_000571108.1.17201 WP_000571108.1.17210 WP_000571108.1.17231 WP_000571108.1.17234 WP_000571108.1.17240 WP_000571108.1.17248 WP_000571108.1.17249 WP_000571108.1.1725 WP_000571108.1.17256 WP_000571108.1.1729 WP_000571108.1.17296 WP_000571108.1.17309 WP_000571108.1.17320 WP_000571108.1.17327 WP_000571108.1.1736 WP_000571108.1.1741 WP_000571108.1.17419 WP_000571108.1.17450 WP_000571108.1.17454 WP_000571108.1.17456 WP_000571108.1.17475 WP_000571108.1.17485 WP_000571108.1.1751 WP_000571108.1.17520 WP_000571108.1.17524 WP_000571108.1.17526 WP_000571108.1.17529 WP_000571108.1.17531 WP_000571108.1.1756 WP_000571108.1.17569 WP_000571108.1.17581 WP_000571108.1.17590 WP_000571108.1.17628 WP_000571108.1.17643 WP_000571108.1.1765 WP_000571108.1.17650 WP_000571108.1.17651 WP_000571108.1.17657 WP_000571108.1.17658 WP_000571108.1.17666 WP_000571108.1.17671 WP_000571108.1.17676 WP_000571108.1.1771 WP_000571108.1.17717 WP_000571108.1.17718 WP_000571108.1.17720 WP_000571108.1.17729 WP_000571108.1.17737 WP_000571108.1.17770 WP_000571108.1.17796 WP_000571108.1.17818 WP_000571108.1.17832 WP_000571108.1.17834 WP_000571108.1.17835 WP_000571108.1.17838 WP_000571108.1.17845 WP_000571108.1.17847 WP_000571108.1.17853 WP_000571108.1.17859 WP_000571108.1.1787 WP_000571108.1.17876 WP_000571108.1.17882 WP_000571108.1.17909 WP_000571108.1.17922 WP_000571108.1.17928 WP_000571108.1.17929 WP_000571108.1.17943 WP_000571108.1.17951 WP_000571108.1.17966 WP_000571108.1.17974 WP_000571108.1.17987 WP_000571108.1.18011 WP_000571108.1.18016 WP_000571108.1.18035 WP_000571108.1.18043 WP_000571108.1.18069 WP_000571108.1.18074 WP_000571108.1.18080 WP_000571108.1.18105 WP_000571108.1.1811 WP_000571108.1.18113 WP_000571108.1.18132 WP_000571108.1.18140 WP_000571108.1.18153 WP_000571108.1.18197 WP_000571108.1.18203 WP_000571108.1.18237 WP_000571108.1.18248 WP_000571108.1.18261 WP_000571108.1.18283 WP_000571108.1.18288 WP_000571108.1.1829 WP_000571108.1.18290 WP_000571108.1.18301 WP_000571108.1.18309 WP_000571108.1.18310 WP_000571108.1.18320 WP_000571108.1.18346 WP_000571108.1.1835 WP_000571108.1.18360 WP_000571108.1.18412 WP_000571108.1.18429 WP_000571108.1.18437 WP_000571108.1.18451 WP_000571108.1.18466 WP_000571108.1.1847 WP_000571108.1.18487 WP_000571108.1.1849 WP_000571108.1.18495 WP_000571108.1.18497 WP_000571108.1.18504 WP_000571108.1.18506 WP_000571108.1.18507 WP_000571108.1.1851 WP_000571108.1.18516 WP_000571108.1.18526 WP_000571108.1.18527 WP_000571108.1.18529 WP_000571108.1.18538 WP_000571108.1.18539 WP_000571108.1.18545 WP_000571108.1.18560 WP_000571108.1.18562 WP_000571108.1.18566 WP_000571108.1.18570 WP_000571108.1.18590 WP_000571108.1.18591 WP_000571108.1.18605 WP_000571108.1.18611 WP_000571108.1.18627 WP_000571108.1.18632 WP_000571108.1.18656 WP_000571108.1.18658 WP_000571108.1.18668 WP_000571108.1.18679 WP_000571108.1.18719 WP_000571108.1.18741 WP_000571108.1.18758 WP_000571108.1.18763 WP_000571108.1.18774 WP_000571108.1.18777 WP_000571108.1.18779 WP_000571108.1.18792 WP_000571108.1.18799 WP_000571108.1.18809 WP_000571108.1.18818 WP_000571108.1.18819 WP_000571108.1.18830 WP_000571108.1.18834 WP_000571108.1.18836 WP_000571108.1.18870 WP_000571108.1.18879 WP_000571108.1.18882 WP_000571108.1.18918 WP_000571108.1.1892 WP_000571108.1.18938 WP_000571108.1.18963 WP_000571108.1.18965 WP_000571108.1.18974 WP_000571108.1.18987 WP_000571108.1.18996 WP_000571108.1.19009 WP_000571108.1.1901 WP_000571108.1.19014 WP_000571108.1.19027 WP_000571108.1.19052 WP_000571108.1.19082 WP_000571108.1.19102 WP_000571108.1.19109 WP_000571108.1.1911 WP_000571108.1.1912 WP_000571108.1.19149 WP_000571108.1.19179 WP_000571108.1.192 WP_000571108.1.1921 WP_000571108.1.19272 WP_000571108.1.19301 WP_000571108.1.19306 WP_000571108.1.19322 WP_000571108.1.19365 WP_000571108.1.19370 WP_000571108.1.19375 WP_000571108.1.19377 WP_000571108.1.19390 WP_000571108.1.19399 WP_000571108.1.19411 WP_000571108.1.1943 WP_000571108.1.19430 WP_000571108.1.19444 WP_000571108.1.19450 WP_000571108.1.19455 WP_000571108.1.19497 WP_000571108.1.19509 WP_000571108.1.19515 WP_000571108.1.19537 WP_000571108.1.19555 WP_000571108.1.19575 WP_000571108.1.19577 WP_000571108.1.19611 WP_000571108.1.1962 WP_000571108.1.1964 WP_000571108.1.19643 WP_000571108.1.19653 WP_000571108.1.19700 WP_000571108.1.19701 WP_000571108.1.19717 WP_000571108.1.19732 WP_000571108.1.19733 WP_000571108.1.1974 WP_000571108.1.19748 WP_000571108.1.1975 WP_000571108.1.19759 WP_000571108.1.19765 WP_000571108.1.19775 WP_000571108.1.19792 WP_000571108.1.19801 WP_000571108.1.19807 WP_000571108.1.19816 WP_000571108.1.19848 WP_000571108.1.19853 WP_000571108.1.19881 WP_000571108.1.19891 WP_000571108.1.19904 WP_000571108.1.19905 WP_000571108.1.19912 WP_000571108.1.19921 WP_000571108.1.19928 WP_000571108.1.19968 WP_000571108.1.19980 WP_000571108.1.19981 WP_000571108.1.19982 WP_000571108.1.2 WP_000571108.1.20006 WP_000571108.1.20049 WP_000571108.1.20052 WP_000571108.1.20057 WP_000571108.1.2007 WP_000571108.1.20078 WP_000571108.1.2008 WP_000571108.1.20090 WP_000571108.1.20100 WP_000571108.1.20101 WP_000571108.1.2013 WP_000571108.1.20155 WP_000571108.1.20156 WP_000571108.1.20160 WP_000571108.1.20161 WP_000571108.1.20167 WP_000571108.1.20177 WP_000571108.1.20191 WP_000571108.1.20201 WP_000571108.1.20210 WP_000571108.1.20214 WP_000571108.1.20219 WP_000571108.1.20221 WP_000571108.1.20235 WP_000571108.1.20245 WP_000571108.1.2025 WP_000571108.1.20265 WP_000571108.1.2029 WP_000571108.1.20307 WP_000571108.1.20324 WP_000571108.1.20340 WP_000571108.1.20354 WP_000571108.1.20358 WP_000571108.1.20386 WP_000571108.1.20394 WP_000571108.1.20398 WP_000571108.1.20399 WP_000571108.1.20411 WP_000571108.1.20447 WP_000571108.1.20473 WP_000571108.1.20479 WP_000571108.1.20487 WP_000571108.1.20496 WP_000571108.1.20500 WP_000571108.1.20512 WP_000571108.1.20550 WP_000571108.1.20554 WP_000571108.1.20558 WP_000571108.1.2056 WP_000571108.1.20574 WP_000571108.1.20579 WP_000571108.1.20585 WP_000571108.1.20598 WP_000571108.1.20611 WP_000571108.1.20618 WP_000571108.1.20619 WP_000571108.1.20620 WP_000571108.1.20661 WP_000571108.1.20698 WP_000571108.1.20736 WP_000571108.1.20772 WP_000571108.1.2079 WP_000571108.1.20796 WP_000571108.1.20821 WP_000571108.1.20833 WP_000571108.1.20838 WP_000571108.1.20846 WP_000571108.1.20860 WP_000571108.1.20866 WP_000571108.1.20867 WP_000571108.1.20878 WP_000571108.1.20906 WP_000571108.1.20913 WP_000571108.1.20922 WP_000571108.1.20935 WP_000571108.1.20939 WP_000571108.1.20945 WP_000571108.1.20971 WP_000571108.1.20975 WP_000571108.1.20979 WP_000571108.1.21009 WP_000571108.1.21013 WP_000571108.1.21015 WP_000571108.1.21031 WP_000571108.1.21036 WP_000571108.1.21054 WP_000571108.1.21056 WP_000571108.1.21064 WP_000571108.1.21066 WP_000571108.1.21078 WP_000571108.1.21080 WP_000571108.1.21081 WP_000571108.1.21102 WP_000571108.1.21109 WP_000571108.1.21111 WP_000571108.1.21140 WP_000571108.1.21154 WP_000571108.1.21183 WP_000571108.1.2119 WP_000571108.1.21222 WP_000571108.1.21257 WP_000571108.1.21259 WP_000571108.1.21272 WP_000571108.1.2128 WP_000571108.1.21312 WP_000571108.1.21313 WP_000571108.1.21314 WP_000571108.1.21339 WP_000571108.1.2135 WP_000571108.1.21356 WP_000571108.1.21359 WP_000571108.1.21375 WP_000571108.1.21379 WP_000571108.1.21386 WP_000571108.1.21393 WP_000571108.1.21402 WP_000571108.1.21412 WP_000571108.1.21416 WP_000571108.1.21449 WP_000571108.1.21458 WP_000571108.1.21464 WP_000571108.1.21465 WP_000571108.1.21477 WP_000571108.1.21480 WP_000571108.1.21500 WP_000571108.1.21505 WP_000571108.1.21514 WP_000571108.1.2154 WP_000571108.1.21572 WP_000571108.1.21583 WP_000571108.1.21589 WP_000571108.1.2159 WP_000571108.1.2160 WP_000571108.1.21601 WP_000571108.1.21636 WP_000571108.1.21679 WP_000571108.1.21712 WP_000571108.1.21719 WP_000571108.1.21724 WP_000571108.1.21746 WP_000571108.1.21763 WP_000571108.1.2178 WP_000571108.1.21787 WP_000571108.1.21820 WP_000571108.1.21828 WP_000571108.1.21830 WP_000571108.1.21890 WP_000571108.1.21894 WP_000571108.1.21900 WP_000571108.1.21901 WP_000571108.1.21919 WP_000571108.1.21954 WP_000571108.1.21985 WP_000571108.1.21988 WP_000571108.1.2200 WP_000571108.1.22000 WP_000571108.1.22011 WP_000571108.1.22022 WP_000571108.1.22027 WP_000571108.1.22033 WP_000571108.1.22038 WP_000571108.1.22045 WP_000571108.1.22049 WP_000571108.1.22082 WP_000571108.1.22093 WP_000571108.1.2211 WP_000571108.1.22111 WP_000571108.1.22149 WP_000571108.1.22163 WP_000571108.1.22164 WP_000571108.1.22165 WP_000571108.1.22170 WP_000571108.1.22174 WP_000571108.1.22177 WP_000571108.1.22180 WP_000571108.1.22197 WP_000571108.1.22200 WP_000571108.1.22227 WP_000571108.1.22246 WP_000571108.1.22259 WP_000571108.1.22302 WP_000571108.1.22332 WP_000571108.1.22344 WP_000571108.1.22351 WP_000571108.1.22367 WP_000571108.1.22400 WP_000571108.1.22418 WP_000571108.1.22419 WP_000571108.1.22426 WP_000571108.1.22441 WP_000571108.1.22493 WP_000571108.1.22498 WP_000571108.1.22512 WP_000571108.1.22526 WP_000571108.1.22533 WP_000571108.1.22547 WP_000571108.1.22551 WP_000571108.1.22559 WP_000571108.1.22650 WP_000571108.1.22657 WP_000571108.1.22684 WP_000571108.1.22696 WP_000571108.1.22702 WP_000571108.1.22709 WP_000571108.1.22727 WP_000571108.1.22730 WP_000571108.1.22731 WP_000571108.1.22738 WP_000571108.1.22739 WP_000571108.1.22764 WP_000571108.1.22787 WP_000571108.1.22789 WP_000571108.1.22790 WP_000571108.1.22792 WP_000571108.1.2280 WP_000571108.1.22803 WP_000571108.1.22808 WP_000571108.1.22811 WP_000571108.1.22826 WP_000571108.1.22843 WP_000571108.1.22853 WP_000571108.1.22859 WP_000571108.1.22861 WP_000571108.1.22869 WP_000571108.1.22890 WP_000571108.1.22924 WP_000571108.1.22969 WP_000571108.1.22975 WP_000571108.1.22983 WP_000571108.1.22984 WP_000571108.1.22994 WP_000571108.1.23004 WP_000571108.1.23008 WP_000571108.1.23012 WP_000571108.1.23048 WP_000571108.1.23061 WP_000571108.1.23069 WP_000571108.1.23082 WP_000571108.1.23103 WP_000571108.1.23121 WP_000571108.1.23130 WP_000571108.1.23132 WP_000571108.1.23133 WP_000571108.1.23146 WP_000571108.1.23152 WP_000571108.1.23161 WP_000571108.1.23185 WP_000571108.1.23197 WP_000571108.1.23217 WP_000571108.1.23222 WP_000571108.1.23228 WP_000571108.1.23238 WP_000571108.1.23244 WP_000571108.1.23251 WP_000571108.1.2327 WP_000571108.1.23275 WP_000571108.1.23288 WP_000571108.1.23304 WP_000571108.1.23381 WP_000571108.1.23413 WP_000571108.1.23420 WP_000571108.1.23431 WP_000571108.1.23439 WP_000571108.1.23449 WP_000571108.1.23450 WP_000571108.1.23476 WP_000571108.1.23489 WP_000571108.1.23491 WP_000571108.1.23516 WP_000571108.1.23517 WP_000571108.1.23531 WP_000571108.1.23541 WP_000571108.1.23544 WP_000571108.1.23557 WP_000571108.1.23572 WP_000571108.1.23586 WP_000571108.1.23613 WP_000571108.1.23626 WP_000571108.1.23630 WP_000571108.1.23644 WP_000571108.1.2365 WP_000571108.1.23671 WP_000571108.1.23690 WP_000571108.1.23708 WP_000571108.1.23730 WP_000571108.1.23740 WP_000571108.1.23796 WP_000571108.1.23809 WP_000571108.1.2382 WP_000571108.1.23822 WP_000571108.1.23842 WP_000571108.1.23849 WP_000571108.1.23856 WP_000571108.1.2389 WP_000571108.1.23896 WP_000571108.1.23900 WP_000571108.1.23907 WP_000571108.1.23926 WP_000571108.1.23935 WP_000571108.1.23956 WP_000571108.1.23972 WP_000571108.1.23995 WP_000571108.1.23998 WP_000571108.1.24000 WP_000571108.1.24081 WP_000571108.1.24129 WP_000571108.1.24148 WP_000571108.1.24154 WP_000571108.1.24167 WP_000571108.1.24174 WP_000571108.1.2420 WP_000571108.1.24207 WP_000571108.1.24213 WP_000571108.1.24226 WP_000571108.1.2423 WP_000571108.1.24241 WP_000571108.1.24263 WP_000571108.1.2427 WP_000571108.1.24275 WP_000571108.1.24276 WP_000571108.1.24277 WP_000571108.1.24279 WP_000571108.1.24286 WP_000571108.1.24302 WP_000571108.1.24343 WP_000571108.1.24347 WP_000571108.1.24364 WP_000571108.1.24365 WP_000571108.1.24416 WP_000571108.1.24418 WP_000571108.1.2442 WP_000571108.1.24436 WP_000571108.1.24437 WP_000571108.1.24439 WP_000571108.1.24443 WP_000571108.1.24462 WP_000571108.1.24469 WP_000571108.1.24478 WP_000571108.1.2450 WP_000571108.1.24502 WP_000571108.1.24516 WP_000571108.1.24569 WP_000571108.1.24572 WP_000571108.1.2458 WP_000571108.1.24589 WP_000571108.1.24596 WP_000571108.1.24597 WP_000571108.1.24602 WP_000571108.1.24617 WP_000571108.1.24625 WP_000571108.1.24631 WP_000571108.1.24644 WP_000571108.1.24654 WP_000571108.1.24674 WP_000571108.1.24679 WP_000571108.1.24685 WP_000571108.1.24711 WP_000571108.1.24714 WP_000571108.1.24745 WP_000571108.1.24780 WP_000571108.1.24781 WP_000571108.1.2480 WP_000571108.1.24802 WP_000571108.1.24817 WP_000571108.1.24823 WP_000571108.1.24834 WP_000571108.1.24855 WP_000571108.1.24856 WP_000571108.1.24891 WP_000571108.1.24937 WP_000571108.1.2497 WP_000571108.1.24996 WP_000571108.1.25001 WP_000571108.1.25007 WP_000571108.1.2501 WP_000571108.1.25012 WP_000571108.1.25029 WP_000571108.1.2506 WP_000571108.1.25070 WP_000571108.1.25083 WP_000571108.1.25092 WP_000571108.1.25098 WP_000571108.1.25115 WP_000571108.1.25117 WP_000571108.1.25145 WP_000571108.1.25167 WP_000571108.1.25170 WP_000571108.1.25187 WP_000571108.1.25209 WP_000571108.1.25216 WP_000571108.1.2522 WP_000571108.1.25221 WP_000571108.1.25262 WP_000571108.1.25287 WP_000571108.1.25288 WP_000571108.1.25331 WP_000571108.1.25341 WP_000571108.1.25345 WP_000571108.1.25361 WP_000571108.1.25438 WP_000571108.1.25459 WP_000571108.1.25469 WP_000571108.1.25479 WP_000571108.1.25488 WP_000571108.1.25489 WP_000571108.1.25495 WP_000571108.1.25511 WP_000571108.1.2552 WP_000571108.1.25557 WP_000571108.1.25567 WP_000571108.1.25569 WP_000571108.1.25591 WP_000571108.1.25593 WP_000571108.1.25595 WP_000571108.1.25597 WP_000571108.1.25621 WP_000571108.1.25623 WP_000571108.1.25634 WP_000571108.1.25651 WP_000571108.1.257 WP_000571108.1.25721 WP_000571108.1.25732 WP_000571108.1.25737 WP_000571108.1.25744 WP_000571108.1.25758 WP_000571108.1.25770 WP_000571108.1.25772 WP_000571108.1.25776 WP_000571108.1.25779 WP_000571108.1.2579 WP_000571108.1.25802 WP_000571108.1.25820 WP_000571108.1.25840 WP_000571108.1.25852 WP_000571108.1.25856 WP_000571108.1.25857 WP_000571108.1.25867 WP_000571108.1.25868 WP_000571108.1.25881 WP_000571108.1.25891 WP_000571108.1.2590 WP_000571108.1.25910 WP_000571108.1.2592 WP_000571108.1.25924 WP_000571108.1.25929 WP_000571108.1.2593 WP_000571108.1.25930 WP_000571108.1.25955 WP_000571108.1.25984 WP_000571108.1.26006 WP_000571108.1.26012 WP_000571108.1.26015 WP_000571108.1.26033 WP_000571108.1.26039 WP_000571108.1.26050 WP_000571108.1.26058 WP_000571108.1.2608 WP_000571108.1.26086 WP_000571108.1.26094 WP_000571108.1.26106 WP_000571108.1.26143 WP_000571108.1.26169 WP_000571108.1.26172 WP_000571108.1.2619 WP_000571108.1.262 WP_000571108.1.2621 WP_000571108.1.26225 WP_000571108.1.26226 WP_000571108.1.26255 WP_000571108.1.26266 WP_000571108.1.26271 WP_000571108.1.26276 WP_000571108.1.26283 WP_000571108.1.26289 WP_000571108.1.26290 WP_000571108.1.26293 WP_000571108.1.26298 WP_000571108.1.26307 WP_000571108.1.26314 WP_000571108.1.26315 WP_000571108.1.26318 WP_000571108.1.26340 WP_000571108.1.26345 WP_000571108.1.26354 WP_000571108.1.26359 WP_000571108.1.26364 WP_000571108.1.26370 WP_000571108.1.26397 WP_000571108.1.26399 WP_000571108.1.26404 WP_000571108.1.26405 WP_000571108.1.26424 WP_000571108.1.2643 WP_000571108.1.26431 WP_000571108.1.2645 WP_000571108.1.26481 WP_000571108.1.26506 WP_000571108.1.26533 WP_000571108.1.2656 WP_000571108.1.2658 WP_000571108.1.26584 WP_000571108.1.2661 WP_000571108.1.26626 WP_000571108.1.2664 WP_000571108.1.26650 WP_000571108.1.26662 WP_000571108.1.26663 WP_000571108.1.26664 WP_000571108.1.26677 WP_000571108.1.26692 WP_000571108.1.26726 WP_000571108.1.2673 WP_000571108.1.26733 WP_000571108.1.26749 WP_000571108.1.26751 WP_000571108.1.26771 WP_000571108.1.26772 WP_000571108.1.26773 WP_000571108.1.26778 WP_000571108.1.26790 WP_000571108.1.2680 WP_000571108.1.26804 WP_000571108.1.2684 WP_000571108.1.26840 WP_000571108.1.26850 WP_000571108.1.26864 WP_000571108.1.26865 WP_000571108.1.2687 WP_000571108.1.26884 WP_000571108.1.26886 WP_000571108.1.2689 WP_000571108.1.26903 WP_000571108.1.26905 WP_000571108.1.26927 WP_000571108.1.26929 WP_000571108.1.26938 WP_000571108.1.26944 WP_000571108.1.26947 WP_000571108.1.26958 WP_000571108.1.26963 WP_000571108.1.2697 WP_000571108.1.27013 WP_000571108.1.27042 WP_000571108.1.27053 WP_000571108.1.27080 WP_000571108.1.27083 WP_000571108.1.27097 WP_000571108.1.2710 WP_000571108.1.27120 WP_000571108.1.27127 WP_000571108.1.27147 WP_000571108.1.27154 WP_000571108.1.27160 WP_000571108.1.27166 WP_000571108.1.27168 WP_000571108.1.27170 WP_000571108.1.27182 WP_000571108.1.2719 WP_000571108.1.27207 WP_000571108.1.27226 WP_000571108.1.27237 WP_000571108.1.27246 WP_000571108.1.27262 WP_000571108.1.27293 WP_000571108.1.27294 WP_000571108.1.27303 WP_000571108.1.27311 WP_000571108.1.27323 WP_000571108.1.27333 WP_000571108.1.2734 WP_000571108.1.27345 WP_000571108.1.27379 WP_000571108.1.27384 WP_000571108.1.27387 WP_000571108.1.27413 WP_000571108.1.27415 WP_000571108.1.2744 WP_000571108.1.27455 WP_000571108.1.27456 WP_000571108.1.27457 WP_000571108.1.27467 WP_000571108.1.27468 WP_000571108.1.27489 WP_000571108.1.27516 WP_000571108.1.27529 WP_000571108.1.2753 WP_000571108.1.27539 WP_000571108.1.27551 WP_000571108.1.27562 WP_000571108.1.2759 WP_000571108.1.27590 WP_000571108.1.27608 WP_000571108.1.27614 WP_000571108.1.27615 WP_000571108.1.27621 WP_000571108.1.27622 WP_000571108.1.27628 WP_000571108.1.27640 WP_000571108.1.27646 WP_000571108.1.27654 WP_000571108.1.27662 WP_000571108.1.27667 WP_000571108.1.27670 WP_000571108.1.27673 WP_000571108.1.2768 WP_000571108.1.27689 WP_000571108.1.27696 WP_000571108.1.27717 WP_000571108.1.27720 WP_000571108.1.27739 WP_000571108.1.27744 WP_000571108.1.27748 WP_000571108.1.27765 WP_000571108.1.27787 WP_000571108.1.27793 WP_000571108.1.27799 WP_000571108.1.27817 WP_000571108.1.27834 WP_000571108.1.27854 WP_000571108.1.27929 WP_000571108.1.2795 WP_000571108.1.27950 WP_000571108.1.27953 WP_000571108.1.27972 WP_000571108.1.27999 WP_000571108.1.2800 WP_000571108.1.28007 WP_000571108.1.28016 WP_000571108.1.28025 WP_000571108.1.28063 WP_000571108.1.28071 WP_000571108.1.28074 WP_000571108.1.28079 WP_000571108.1.2808 WP_000571108.1.28088 WP_000571108.1.28091 WP_000571108.1.28105 WP_000571108.1.28107 WP_000571108.1.28117 WP_000571108.1.28138 WP_000571108.1.28147 WP_000571108.1.28158 WP_000571108.1.28173 WP_000571108.1.28191 WP_000571108.1.28207 WP_000571108.1.28213 WP_000571108.1.28226 WP_000571108.1.28230 WP_000571108.1.28257 WP_000571108.1.28274 WP_000571108.1.28298 WP_000571108.1.28315 WP_000571108.1.28319 WP_000571108.1.28336 WP_000571108.1.28337 WP_000571108.1.28347 WP_000571108.1.28358 WP_000571108.1.28360 WP_000571108.1.28376 WP_000571108.1.28381 WP_000571108.1.28388 WP_000571108.1.28392 WP_000571108.1.28394 WP_000571108.1.2840 WP_000571108.1.28400 WP_000571108.1.28430 WP_000571108.1.28447 WP_000571108.1.28477 WP_000571108.1.28482 WP_000571108.1.28490 WP_000571108.1.28498 WP_000571108.1.28501 WP_000571108.1.28502 WP_000571108.1.2852 WP_000571108.1.28526 WP_000571108.1.28527 WP_000571108.1.28532 WP_000571108.1.28564 WP_000571108.1.28578 WP_000571108.1.28580 WP_000571108.1.28584 WP_000571108.1.28605 WP_000571108.1.28614 WP_000571108.1.2862 WP_000571108.1.28629 WP_000571108.1.28636 WP_000571108.1.28650 WP_000571108.1.28652 WP_000571108.1.28675 WP_000571108.1.28691 WP_000571108.1.28710 WP_000571108.1.28720 WP_000571108.1.28725 WP_000571108.1.28763 WP_000571108.1.28784 WP_000571108.1.28785 WP_000571108.1.28825 WP_000571108.1.28833 WP_000571108.1.28848 WP_000571108.1.28862 WP_000571108.1.28871 WP_000571108.1.28887 WP_000571108.1.28909 WP_000571108.1.2891 WP_000571108.1.28925 WP_000571108.1.28933 WP_000571108.1.28934 WP_000571108.1.28960 WP_000571108.1.28970 WP_000571108.1.28981 WP_000571108.1.28987 WP_000571108.1.29014 WP_000571108.1.29052 WP_000571108.1.2906 WP_000571108.1.29060 WP_000571108.1.29090 WP_000571108.1.29091 WP_000571108.1.29107 WP_000571108.1.29110 WP_000571108.1.29112 WP_000571108.1.2913 WP_000571108.1.29155 WP_000571108.1.29166 WP_000571108.1.29170 WP_000571108.1.29187 WP_000571108.1.29188 WP_000571108.1.29207 WP_000571108.1.29226 WP_000571108.1.29242 WP_000571108.1.29244 WP_000571108.1.29250 WP_000571108.1.29263 WP_000571108.1.29272 WP_000571108.1.29276 WP_000571108.1.29282 WP_000571108.1.29285 WP_000571108.1.29301 WP_000571108.1.29312 WP_000571108.1.29329 WP_000571108.1.29340 WP_000571108.1.29366 WP_000571108.1.29368 WP_000571108.1.29372 WP_000571108.1.29373 WP_000571108.1.29375 WP_000571108.1.29381 WP_000571108.1.29395 WP_000571108.1.29420 WP_000571108.1.29433 WP_000571108.1.29453 WP_000571108.1.29468 WP_000571108.1.29479 WP_000571108.1.29483 WP_000571108.1.29484 WP_000571108.1.29511 WP_000571108.1.29522 WP_000571108.1.29541 WP_000571108.1.29554 WP_000571108.1.29557 WP_000571108.1.29561 WP_000571108.1.2957 WP_000571108.1.29571 WP_000571108.1.29596 WP_000571108.1.29644 WP_000571108.1.29676 WP_000571108.1.29692 WP_000571108.1.29709 WP_000571108.1.29710 WP_000571108.1.2972 WP_000571108.1.29731 WP_000571108.1.29736 WP_000571108.1.29744 WP_000571108.1.2975 WP_000571108.1.29758 WP_000571108.1.29781 WP_000571108.1.29788 WP_000571108.1.29805 WP_000571108.1.2981 WP_000571108.1.2983 WP_000571108.1.29862 WP_000571108.1.29885 WP_000571108.1.29902 WP_000571108.1.29905 WP_000571108.1.29918 WP_000571108.1.29956 WP_000571108.1.29963 WP_000571108.1.2997 WP_000571108.1.29981 WP_000571108.1.29982 WP_000571108.1.30012 WP_000571108.1.30023 WP_000571108.1.30033 WP_000571108.1.30047 WP_000571108.1.30051 WP_000571108.1.30057 WP_000571108.1.30089 WP_000571108.1.30095 WP_000571108.1.30100 WP_000571108.1.30115 WP_000571108.1.3012 WP_000571108.1.30130 WP_000571108.1.30150 WP_000571108.1.30152 WP_000571108.1.30154 WP_000571108.1.30159 WP_000571108.1.30169 WP_000571108.1.30176 WP_000571108.1.30186 WP_000571108.1.30188 WP_000571108.1.30190 WP_000571108.1.30191 WP_000571108.1.30197 WP_000571108.1.30203 WP_000571108.1.30204 WP_000571108.1.30209 WP_000571108.1.30230 WP_000571108.1.30249 WP_000571108.1.30262 WP_000571108.1.30268 WP_000571108.1.30274 WP_000571108.1.30294 WP_000571108.1.30302 WP_000571108.1.30307 WP_000571108.1.30328 WP_000571108.1.30333 WP_000571108.1.30364 WP_000571108.1.30367 WP_000571108.1.30376 WP_000571108.1.30381 WP_000571108.1.30385 WP_000571108.1.30392 WP_000571108.1.30418 WP_000571108.1.30422 WP_000571108.1.30458 WP_000571108.1.30477 WP_000571108.1.30482 WP_000571108.1.3050 WP_000571108.1.30508 WP_000571108.1.30530 WP_000571108.1.30531 WP_000571108.1.30560 WP_000571108.1.30566 WP_000571108.1.30568 WP_000571108.1.30600 WP_000571108.1.30622 WP_000571108.1.30623 WP_000571108.1.30645 WP_000571108.1.30646 WP_000571108.1.30648 WP_000571108.1.30650 WP_000571108.1.30652 WP_000571108.1.30666 WP_000571108.1.30668 WP_000571108.1.30690 WP_000571108.1.30702 WP_000571108.1.30720 WP_000571108.1.30726 WP_000571108.1.30758 WP_000571108.1.30763 WP_000571108.1.30768 WP_000571108.1.3077 WP_000571108.1.30779 WP_000571108.1.30845 WP_000571108.1.30846 WP_000571108.1.30847 WP_000571108.1.30854 WP_000571108.1.30861 WP_000571108.1.30862 WP_000571108.1.30863 WP_000571108.1.30874 WP_000571108.1.30878 WP_000571108.1.30880 WP_000571108.1.30889 WP_000571108.1.30907 WP_000571108.1.30915 WP_000571108.1.30916 WP_000571108.1.30928 WP_000571108.1.30945 WP_000571108.1.30962 WP_000571108.1.3097 WP_000571108.1.30970 WP_000571108.1.30971 WP_000571108.1.30998 WP_000571108.1.31005 WP_000571108.1.31022 WP_000571108.1.31037 WP_000571108.1.31039 WP_000571108.1.31041 WP_000571108.1.31048 WP_000571108.1.31065 WP_000571108.1.31068 WP_000571108.1.31077 WP_000571108.1.31091 WP_000571108.1.31113 WP_000571108.1.31114 WP_000571108.1.31120 WP_000571108.1.31123 WP_000571108.1.31124 WP_000571108.1.31176 WP_000571108.1.31194 WP_000571108.1.31206 WP_000571108.1.31232 WP_000571108.1.31278 WP_000571108.1.31294 WP_000571108.1.31315 WP_000571108.1.3132 WP_000571108.1.31337 WP_000571108.1.31339 WP_000571108.1.31355 WP_000571108.1.31363 WP_000571108.1.31376 WP_000571108.1.31402 WP_000571108.1.31424 WP_000571108.1.31436 WP_000571108.1.31437 WP_000571108.1.31441 WP_000571108.1.31442 WP_000571108.1.31462 WP_000571108.1.31468 WP_000571108.1.31478 WP_000571108.1.31479 WP_000571108.1.31484 WP_000571108.1.31497 WP_000571108.1.315 WP_000571108.1.31529 WP_000571108.1.31531 WP_000571108.1.31539 WP_000571108.1.31567 WP_000571108.1.31568 WP_000571108.1.31589 WP_000571108.1.31605 WP_000571108.1.31611 WP_000571108.1.31642 WP_000571108.1.31647 WP_000571108.1.31653 WP_000571108.1.31667 WP_000571108.1.31686 WP_000571108.1.31701 WP_000571108.1.31743 WP_000571108.1.31753 WP_000571108.1.31787 WP_000571108.1.31791 WP_000571108.1.31797 WP_000571108.1.31806 WP_000571108.1.31816 WP_000571108.1.31817 WP_000571108.1.31827 WP_000571108.1.31828 WP_000571108.1.31842 WP_000571108.1.3188 WP_000571108.1.31892 WP_000571108.1.31897 WP_000571108.1.31925 WP_000571108.1.31931 WP_000571108.1.31949 WP_000571108.1.31990 WP_000571108.1.31994 WP_000571108.1.31997 WP_000571108.1.32003 WP_000571108.1.32005 WP_000571108.1.32029 WP_000571108.1.32040 WP_000571108.1.32059 WP_000571108.1.32067 WP_000571108.1.32077 WP_000571108.1.32095 WP_000571108.1.32106 WP_000571108.1.32118 WP_000571108.1.32122 WP_000571108.1.32125 WP_000571108.1.32160 WP_000571108.1.32167 WP_000571108.1.3219 WP_000571108.1.32207 WP_000571108.1.32217 WP_000571108.1.32244 WP_000571108.1.32248 WP_000571108.1.32269 WP_000571108.1.32270 WP_000571108.1.32281 WP_000571108.1.3229 WP_000571108.1.32295 WP_000571108.1.32301 WP_000571108.1.3231 WP_000571108.1.32325 WP_000571108.1.32338 WP_000571108.1.32339 WP_000571108.1.32340 WP_000571108.1.32365 WP_000571108.1.32384 WP_000571108.1.32405 WP_000571108.1.3242 WP_000571108.1.3244 WP_000571108.1.32454 WP_000571108.1.32464 WP_000571108.1.32474 WP_000571108.1.32481 WP_000571108.1.32483 WP_000571108.1.32497 WP_000571108.1.32514 WP_000571108.1.32517 WP_000571108.1.32534 WP_000571108.1.32546 WP_000571108.1.32555 WP_000571108.1.32565 WP_000571108.1.32584 WP_000571108.1.32588 WP_000571108.1.32599 WP_000571108.1.32607 WP_000571108.1.32634 WP_000571108.1.32636 WP_000571108.1.32645 WP_000571108.1.32671 WP_000571108.1.32739 WP_000571108.1.32746 WP_000571108.1.32754 WP_000571108.1.32761 WP_000571108.1.32763 WP_000571108.1.32764 WP_000571108.1.32770 WP_000571108.1.32795 WP_000571108.1.328 WP_000571108.1.32800 WP_000571108.1.32829 WP_000571108.1.32839 WP_000571108.1.32898 WP_000571108.1.32921 WP_000571108.1.32925 WP_000571108.1.32928 WP_000571108.1.32939 WP_000571108.1.32954 WP_000571108.1.32965 WP_000571108.1.32980 WP_000571108.1.32987 WP_000571108.1.3299 WP_000571108.1.3301 WP_000571108.1.33029 WP_000571108.1.33038 WP_000571108.1.33048 WP_000571108.1.3306 WP_000571108.1.33108 WP_000571108.1.33110 WP_000571108.1.33123 WP_000571108.1.33138 WP_000571108.1.33147 WP_000571108.1.3316 WP_000571108.1.33161 WP_000571108.1.33199 WP_000571108.1.33212 WP_000571108.1.33213 WP_000571108.1.33250 WP_000571108.1.33252 WP_000571108.1.33255 WP_000571108.1.33266 WP_000571108.1.33277 WP_000571108.1.33292 WP_000571108.1.33296 WP_000571108.1.3330 WP_000571108.1.33307 WP_000571108.1.33322 WP_000571108.1.33328 WP_000571108.1.33335 WP_000571108.1.3335 WP_000571108.1.33350 WP_000571108.1.33357 WP_000571108.1.33368 WP_000571108.1.33372 WP_000571108.1.3338 WP_000571108.1.33388 WP_000571108.1.33394 WP_000571108.1.33416 WP_000571108.1.3342 WP_000571108.1.33426 WP_000571108.1.3343 WP_000571108.1.33432 WP_000571108.1.3345 WP_000571108.1.33463 WP_000571108.1.33468 WP_000571108.1.3347 WP_000571108.1.33483 WP_000571108.1.33484 WP_000571108.1.33507 WP_000571108.1.33516 WP_000571108.1.33518 WP_000571108.1.33520 WP_000571108.1.33538 WP_000571108.1.33540 WP_000571108.1.33567 WP_000571108.1.3357 WP_000571108.1.33575 WP_000571108.1.3358 WP_000571108.1.33594 WP_000571108.1.33607 WP_000571108.1.33626 WP_000571108.1.33627 WP_000571108.1.3363 WP_000571108.1.33640 WP_000571108.1.33650 WP_000571108.1.33654 WP_000571108.1.33655 WP_000571108.1.33692 WP_000571108.1.33695 WP_000571108.1.33707 WP_000571108.1.33718 WP_000571108.1.33720 WP_000571108.1.33724 WP_000571108.1.33735 WP_000571108.1.33737 WP_000571108.1.33743 WP_000571108.1.33756 WP_000571108.1.33766 WP_000571108.1.33767 WP_000571108.1.33769 WP_000571108.1.33778 WP_000571108.1.33792 WP_000571108.1.33804 WP_000571108.1.33813 WP_000571108.1.33850 WP_000571108.1.33855 WP_000571108.1.33899 WP_000571108.1.33915 WP_000571108.1.33949 WP_000571108.1.33968 WP_000571108.1.33971 WP_000571108.1.33983 WP_000571108.1.33989 WP_000571108.1.33994 WP_000571108.1.34026 WP_000571108.1.34030 WP_000571108.1.34051 WP_000571108.1.34060 WP_000571108.1.34062 WP_000571108.1.34069 WP_000571108.1.34078 WP_000571108.1.34079 WP_000571108.1.34100 WP_000571108.1.34105 WP_000571108.1.34112 WP_000571108.1.34128 WP_000571108.1.34132 WP_000571108.1.34168 WP_000571108.1.34172 WP_000571108.1.3418 WP_000571108.1.34182 WP_000571108.1.34194 WP_000571108.1.34209 WP_000571108.1.3422 WP_000571108.1.34231 WP_000571108.1.34244 WP_000571108.1.34250 WP_000571108.1.34251 WP_000571108.1.34254 WP_000571108.1.34285 WP_000571108.1.34307 WP_000571108.1.34371 WP_000571108.1.34381 WP_000571108.1.34403 WP_000571108.1.34410 WP_000571108.1.3442 WP_000571108.1.34427 WP_000571108.1.34438 WP_000571108.1.34471 WP_000571108.1.34473 WP_000571108.1.3448 WP_000571108.1.34482 WP_000571108.1.34492 WP_000571108.1.34502 WP_000571108.1.34510 WP_000571108.1.34512 WP_000571108.1.34526 WP_000571108.1.34531 WP_000571108.1.34569 WP_000571108.1.34578 WP_000571108.1.3461 WP_000571108.1.34620 WP_000571108.1.34626 WP_000571108.1.34666 WP_000571108.1.34677 WP_000571108.1.34716 WP_000571108.1.34723 WP_000571108.1.34733 WP_000571108.1.34737 WP_000571108.1.3474 WP_000571108.1.34741 WP_000571108.1.34767 WP_000571108.1.34774 WP_000571108.1.34818 WP_000571108.1.34847 WP_000571108.1.34865 WP_000571108.1.34877 WP_000571108.1.34890 WP_000571108.1.34912 WP_000571108.1.34918 WP_000571108.1.34923 WP_000571108.1.34926 WP_000571108.1.34943 WP_000571108.1.34967 WP_000571108.1.34970 WP_000571108.1.34998 WP_000571108.1.35014 WP_000571108.1.35031 WP_000571108.1.35032 WP_000571108.1.35054 WP_000571108.1.35059 WP_000571108.1.35062 WP_000571108.1.35089 WP_000571108.1.35097 WP_000571108.1.35106 WP_000571108.1.35108 WP_000571108.1.35110 WP_000571108.1.35121 WP_000571108.1.35177 WP_000571108.1.35182 WP_000571108.1.35189 WP_000571108.1.35194 WP_000571108.1.35222 WP_000571108.1.35233 WP_000571108.1.35243 WP_000571108.1.35257 WP_000571108.1.3526 WP_000571108.1.35264 WP_000571108.1.35276 WP_000571108.1.35285 WP_000571108.1.35289 WP_000571108.1.35297 WP_000571108.1.35314 WP_000571108.1.35334 WP_000571108.1.35340 WP_000571108.1.35342 WP_000571108.1.35345 WP_000571108.1.35352 WP_000571108.1.35391 WP_000571108.1.354 WP_000571108.1.35413 WP_000571108.1.35415 WP_000571108.1.3542 WP_000571108.1.35423 WP_000571108.1.35433 WP_000571108.1.35435 WP_000571108.1.3547 WP_000571108.1.3549 WP_000571108.1.35490 WP_000571108.1.35497 WP_000571108.1.35498 WP_000571108.1.35506 WP_000571108.1.35508 WP_000571108.1.35517 WP_000571108.1.35519 WP_000571108.1.3552 WP_000571108.1.35525 WP_000571108.1.35549 WP_000571108.1.35580 WP_000571108.1.35615 WP_000571108.1.35623 WP_000571108.1.35642 WP_000571108.1.35643 WP_000571108.1.35661 WP_000571108.1.35673 WP_000571108.1.35686 WP_000571108.1.3569 WP_000571108.1.35696 WP_000571108.1.35730 WP_000571108.1.3574 WP_000571108.1.35742 WP_000571108.1.35774 WP_000571108.1.35784 WP_000571108.1.3579 WP_000571108.1.35794 WP_000571108.1.35799 WP_000571108.1.35801 WP_000571108.1.35826 WP_000571108.1.35837 WP_000571108.1.35888 WP_000571108.1.35890 WP_000571108.1.35903 WP_000571108.1.35928 WP_000571108.1.35950 WP_000571108.1.35958 WP_000571108.1.36004 WP_000571108.1.36021 WP_000571108.1.36041 WP_000571108.1.36082 WP_000571108.1.36093 WP_000571108.1.36102 WP_000571108.1.3611 WP_000571108.1.36117 WP_000571108.1.36119 WP_000571108.1.36141 WP_000571108.1.3617 WP_000571108.1.36175 WP_000571108.1.36176 WP_000571108.1.36179 WP_000571108.1.36187 WP_000571108.1.36188 WP_000571108.1.36193 WP_000571108.1.36208 WP_000571108.1.36220 WP_000571108.1.36223 WP_000571108.1.3623 WP_000571108.1.36231 WP_000571108.1.36249 WP_000571108.1.36250 WP_000571108.1.36264 WP_000571108.1.36278 WP_000571108.1.36282 WP_000571108.1.36283 WP_000571108.1.36302 WP_000571108.1.36307 WP_000571108.1.36344 WP_000571108.1.36389 WP_000571108.1.36430 WP_000571108.1.36434 WP_000571108.1.36522 WP_000571108.1.36532 WP_000571108.1.36535 WP_000571108.1.3655 WP_000571108.1.36551 WP_000571108.1.36570 WP_000571108.1.36580 WP_000571108.1.36600 WP_000571108.1.36604 WP_000571108.1.36615 WP_000571108.1.36640 WP_000571108.1.36646 WP_000571108.1.3666 WP_000571108.1.36689 WP_000571108.1.36697 WP_000571108.1.36698 WP_000571108.1.36704 WP_000571108.1.36729 WP_000571108.1.36745 WP_000571108.1.3675 WP_000571108.1.36754 WP_000571108.1.36770 WP_000571108.1.36773 WP_000571108.1.36783 WP_000571108.1.36793 WP_000571108.1.36796 WP_000571108.1.36797 WP_000571108.1.36809 WP_000571108.1.36814 WP_000571108.1.36820 WP_000571108.1.36823 WP_000571108.1.36847 WP_000571108.1.3685 WP_000571108.1.36858 WP_000571108.1.3687 WP_000571108.1.36884 WP_000571108.1.36888 WP_000571108.1.3690 WP_000571108.1.36903 WP_000571108.1.36911 WP_000571108.1.36916 WP_000571108.1.36955 WP_000571108.1.36962 WP_000571108.1.36979 WP_000571108.1.36980 WP_000571108.1.36983 WP_000571108.1.36997 WP_000571108.1.37002 WP_000571108.1.37016 WP_000571108.1.3703 WP_000571108.1.37044 WP_000571108.1.37045 WP_000571108.1.37055 WP_000571108.1.37080 WP_000571108.1.3709 WP_000571108.1.37091 WP_000571108.1.37120 WP_000571108.1.37121 WP_000571108.1.37130 WP_000571108.1.37132 WP_000571108.1.37134 WP_000571108.1.37145 WP_000571108.1.37159 WP_000571108.1.3718 WP_000571108.1.3719 WP_000571108.1.3722 WP_000571108.1.37220 WP_000571108.1.37304 WP_000571108.1.37335 WP_000571108.1.37336 WP_000571108.1.37341 WP_000571108.1.37343 WP_000571108.1.37354 WP_000571108.1.37378 WP_000571108.1.37398 WP_000571108.1.37408 WP_000571108.1.37411 WP_000571108.1.37424 WP_000571108.1.37435 WP_000571108.1.37453 WP_000571108.1.37467 WP_000571108.1.37525 WP_000571108.1.37536 WP_000571108.1.37546 WP_000571108.1.37563 WP_000571108.1.37578 WP_000571108.1.37583 WP_000571108.1.37602 WP_000571108.1.37605 WP_000571108.1.37606 WP_000571108.1.37624 WP_000571108.1.37636 WP_000571108.1.37644 WP_000571108.1.37652 WP_000571108.1.37669 WP_000571108.1.37679 WP_000571108.1.3774 WP_000571108.1.37749 WP_000571108.1.3776 WP_000571108.1.37764 WP_000571108.1.37771 WP_000571108.1.37781 WP_000571108.1.37788 WP_000571108.1.37795 WP_000571108.1.37815 WP_000571108.1.37828 WP_000571108.1.37851 WP_000571108.1.37855 WP_000571108.1.37866 WP_000571108.1.37875 WP_000571108.1.37878 WP_000571108.1.37891 WP_000571108.1.37906 WP_000571108.1.37907 WP_000571108.1.37929 WP_000571108.1.37953 WP_000571108.1.37987 WP_000571108.1.38007 WP_000571108.1.38020 WP_000571108.1.38030 WP_000571108.1.38034 WP_000571108.1.38038 WP_000571108.1.38057 WP_000571108.1.38070 WP_000571108.1.38082 WP_000571108.1.3809 WP_000571108.1.38100 WP_000571108.1.38111 WP_000571108.1.38128 WP_000571108.1.3813 WP_000571108.1.38136 WP_000571108.1.38148 WP_000571108.1.38160 WP_000571108.1.3817 WP_000571108.1.38177 WP_000571108.1.3820 WP_000571108.1.38212 WP_000571108.1.38222 WP_000571108.1.38229 WP_000571108.1.38230 WP_000571108.1.38232 WP_000571108.1.3827 WP_000571108.1.38276 WP_000571108.1.38282 WP_000571108.1.38304 WP_000571108.1.38309 WP_000571108.1.38311 WP_000571108.1.38330 WP_000571108.1.38339 WP_000571108.1.38346 WP_000571108.1.38383 WP_000571108.1.3842 WP_000571108.1.38435 WP_000571108.1.38453 WP_000571108.1.38489 WP_000571108.1.38491 WP_000571108.1.38493 WP_000571108.1.38516 WP_000571108.1.3852 WP_000571108.1.38522 WP_000571108.1.38546 WP_000571108.1.38551 WP_000571108.1.38555 WP_000571108.1.38557 WP_000571108.1.38600 WP_000571108.1.38607 WP_000571108.1.38612 WP_000571108.1.38637 WP_000571108.1.38651 WP_000571108.1.38658 WP_000571108.1.38669 WP_000571108.1.3867 WP_000571108.1.38674 WP_000571108.1.38688 WP_000571108.1.38721 WP_000571108.1.3875 WP_000571108.1.38760 WP_000571108.1.38786 WP_000571108.1.38788 WP_000571108.1.38823 WP_000571108.1.38836 WP_000571108.1.38841 WP_000571108.1.38858 WP_000571108.1.38875 WP_000571108.1.38885 WP_000571108.1.38890 WP_000571108.1.38926 WP_000571108.1.38927 WP_000571108.1.38931 WP_000571108.1.3894 WP_000571108.1.38940 WP_000571108.1.38941 WP_000571108.1.38943 WP_000571108.1.38972 WP_000571108.1.38973 WP_000571108.1.38979 WP_000571108.1.38985 WP_000571108.1.38989 WP_000571108.1.390 WP_000571108.1.39012 WP_000571108.1.39014 WP_000571108.1.39017 WP_000571108.1.39026 WP_000571108.1.39043 WP_000571108.1.39053 WP_000571108.1.3906 WP_000571108.1.3908 WP_000571108.1.39080 WP_000571108.1.39089 WP_000571108.1.391 WP_000571108.1.39108 WP_000571108.1.39117 WP_000571108.1.39126 WP_000571108.1.39166 WP_000571108.1.39203 WP_000571108.1.39206 WP_000571108.1.39217 WP_000571108.1.39241 WP_000571108.1.3926 WP_000571108.1.39272 WP_000571108.1.39281 WP_000571108.1.39285 WP_000571108.1.39290 WP_000571108.1.39324 WP_000571108.1.39330 WP_000571108.1.39332 WP_000571108.1.39333 WP_000571108.1.39347 WP_000571108.1.39361 WP_000571108.1.39368 WP_000571108.1.39378 WP_000571108.1.39397 WP_000571108.1.39406 WP_000571108.1.39432 WP_000571108.1.39451 WP_000571108.1.39486 WP_000571108.1.39499 WP_000571108.1.39506 WP_000571108.1.39519 WP_000571108.1.39542 WP_000571108.1.39550 WP_000571108.1.39613 WP_000571108.1.39625 WP_000571108.1.39642 WP_000571108.1.39645 WP_000571108.1.39662 WP_000571108.1.39670 WP_000571108.1.39671 WP_000571108.1.39682 WP_000571108.1.39687 WP_000571108.1.39689 WP_000571108.1.39693 WP_000571108.1.39697 WP_000571108.1.39711 WP_000571108.1.39738 WP_000571108.1.39767 WP_000571108.1.39773 WP_000571108.1.39789 WP_000571108.1.39812 WP_000571108.1.39832 WP_000571108.1.39834 WP_000571108.1.39838 WP_000571108.1.39847 WP_000571108.1.39856 WP_000571108.1.39857 WP_000571108.1.39869 WP_000571108.1.39875 WP_000571108.1.39880 WP_000571108.1.39883 WP_000571108.1.39918 WP_000571108.1.39943 WP_000571108.1.39995 WP_000571108.1.40014 WP_000571108.1.40043 WP_000571108.1.40053 WP_000571108.1.4006 WP_000571108.1.40076 WP_000571108.1.40085 WP_000571108.1.40099 WP_000571108.1.4010 WP_000571108.1.40119 WP_000571108.1.4012 WP_000571108.1.40120 WP_000571108.1.40130 WP_000571108.1.40137 WP_000571108.1.40149 WP_000571108.1.4015 WP_000571108.1.40161 WP_000571108.1.40164 WP_000571108.1.40173 WP_000571108.1.4019 WP_000571108.1.40220 WP_000571108.1.40247 WP_000571108.1.4025 WP_000571108.1.40299 WP_000571108.1.40316 WP_000571108.1.40318 WP_000571108.1.40320 WP_000571108.1.40322 WP_000571108.1.40329 WP_000571108.1.40330 WP_000571108.1.40340 WP_000571108.1.40342 WP_000571108.1.40368 WP_000571108.1.40369 WP_000571108.1.40383 WP_000571108.1.40401 WP_000571108.1.40406 WP_000571108.1.40428 WP_000571108.1.40435 WP_000571108.1.40443 WP_000571108.1.4045 WP_000571108.1.40454 WP_000571108.1.40458 WP_000571108.1.40463 WP_000571108.1.40474 WP_000571108.1.40481 WP_000571108.1.40483 WP_000571108.1.40500 WP_000571108.1.40505 WP_000571108.1.40531 WP_000571108.1.40532 WP_000571108.1.40554 WP_000571108.1.4056 WP_000571108.1.4057 WP_000571108.1.40579 WP_000571108.1.40588 WP_000571108.1.40613 WP_000571108.1.40620 WP_000571108.1.40644 WP_000571108.1.40655 WP_000571108.1.40658 WP_000571108.1.40659 WP_000571108.1.40670 WP_000571108.1.40700 WP_000571108.1.40719 WP_000571108.1.40729 WP_000571108.1.40748 WP_000571108.1.40760 WP_000571108.1.40780 WP_000571108.1.40797 WP_000571108.1.40800 WP_000571108.1.40814 WP_000571108.1.40816 WP_000571108.1.40939 WP_000571108.1.40954 WP_000571108.1.40997 WP_000571108.1.41002 WP_000571108.1.41011 WP_000571108.1.4102 WP_000571108.1.41033 WP_000571108.1.41038 WP_000571108.1.4105 WP_000571108.1.41058 WP_000571108.1.41064 WP_000571108.1.41066 WP_000571108.1.41084 WP_000571108.1.41094 WP_000571108.1.41104 WP_000571108.1.41109 WP_000571108.1.41119 WP_000571108.1.41122 WP_000571108.1.41129 WP_000571108.1.41133 WP_000571108.1.4115 WP_000571108.1.41178 WP_000571108.1.41208 WP_000571108.1.41238 WP_000571108.1.41241 WP_000571108.1.41245 WP_000571108.1.41255 WP_000571108.1.41288 WP_000571108.1.41289 WP_000571108.1.4129 WP_000571108.1.41314 WP_000571108.1.41341 WP_000571108.1.41350 WP_000571108.1.41374 WP_000571108.1.4138 WP_000571108.1.41386 WP_000571108.1.41389 WP_000571108.1.41426 WP_000571108.1.41432 WP_000571108.1.41433 WP_000571108.1.4144 WP_000571108.1.41444 WP_000571108.1.41456 WP_000571108.1.41461 WP_000571108.1.41473 WP_000571108.1.41499 WP_000571108.1.41511 WP_000571108.1.41532 WP_000571108.1.41533 WP_000571108.1.41555 WP_000571108.1.41558 WP_000571108.1.41567 WP_000571108.1.41581 WP_000571108.1.41582 WP_000571108.1.41587 WP_000571108.1.41597 WP_000571108.1.41598 WP_000571108.1.41599 WP_000571108.1.4160 WP_000571108.1.41612 WP_000571108.1.4162 WP_000571108.1.41620 WP_000571108.1.41647 WP_000571108.1.41674 WP_000571108.1.41681 WP_000571108.1.4169 WP_000571108.1.41698 WP_000571108.1.41743 WP_000571108.1.41755 WP_000571108.1.41796 WP_000571108.1.41817 WP_000571108.1.4182 WP_000571108.1.41821 WP_000571108.1.41839 WP_000571108.1.41863 WP_000571108.1.4188 WP_000571108.1.41891 WP_000571108.1.41898 WP_000571108.1.41906 WP_000571108.1.41935 WP_000571108.1.41943 WP_000571108.1.41954 WP_000571108.1.41972 WP_000571108.1.41989 WP_000571108.1.420 WP_000571108.1.42001 WP_000571108.1.42003 WP_000571108.1.42005 WP_000571108.1.42015 WP_000571108.1.42017 WP_000571108.1.4202 WP_000571108.1.42028 WP_000571108.1.42056 WP_000571108.1.42072 WP_000571108.1.42085 WP_000571108.1.42087 WP_000571108.1.42125 WP_000571108.1.42137 WP_000571108.1.42169 WP_000571108.1.42177 WP_000571108.1.42178 WP_000571108.1.42198 WP_000571108.1.42241 WP_000571108.1.4225 WP_000571108.1.42269 WP_000571108.1.42286 WP_000571108.1.42298 WP_000571108.1.42305 WP_000571108.1.4231 WP_000571108.1.42325 WP_000571108.1.42336 WP_000571108.1.42344 WP_000571108.1.42355 WP_000571108.1.42403 WP_000571108.1.42436 WP_000571108.1.42438 WP_000571108.1.42455 WP_000571108.1.42459 WP_000571108.1.42460 WP_000571108.1.42481 WP_000571108.1.42503 WP_000571108.1.42510 WP_000571108.1.42517 WP_000571108.1.42551 WP_000571108.1.42575 WP_000571108.1.42593 WP_000571108.1.42598 WP_000571108.1.426 WP_000571108.1.4260 WP_000571108.1.42607 WP_000571108.1.42640 WP_000571108.1.42652 WP_000571108.1.42668 WP_000571108.1.42674 WP_000571108.1.42679 WP_000571108.1.42681 WP_000571108.1.42706 WP_000571108.1.42733 WP_000571108.1.42737 WP_000571108.1.42738 WP_000571108.1.42740 WP_000571108.1.42759 WP_000571108.1.42764 WP_000571108.1.42786 WP_000571108.1.42788 WP_000571108.1.42798 WP_000571108.1.42802 WP_000571108.1.42816 WP_000571108.1.42819 WP_000571108.1.42837 WP_000571108.1.42848 WP_000571108.1.42883 WP_000571108.1.42893 WP_000571108.1.42907 WP_000571108.1.42924 WP_000571108.1.42925 WP_000571108.1.4293 WP_000571108.1.42959 WP_000571108.1.42982 WP_000571108.1.42984 WP_000571108.1.4299 WP_000571108.1.42990 WP_000571108.1.4300 WP_000571108.1.43014 WP_000571108.1.43020 WP_000571108.1.43023 WP_000571108.1.43033 WP_000571108.1.43047 WP_000571108.1.43061 WP_000571108.1.43072 WP_000571108.1.43095 WP_000571108.1.43110 WP_000571108.1.43114 WP_000571108.1.43122 WP_000571108.1.43125 WP_000571108.1.43131 WP_000571108.1.43134 WP_000571108.1.43139 WP_000571108.1.43143 WP_000571108.1.43147 WP_000571108.1.43159 WP_000571108.1.43165 WP_000571108.1.43168 WP_000571108.1.43179 WP_000571108.1.43200 WP_000571108.1.43202 WP_000571108.1.43204 WP_000571108.1.43206 WP_000571108.1.43220 WP_000571108.1.43232 WP_000571108.1.43248 WP_000571108.1.4325 WP_000571108.1.43252 WP_000571108.1.43263 WP_000571108.1.4327 WP_000571108.1.43274 WP_000571108.1.43279 WP_000571108.1.43323 WP_000571108.1.43325 WP_000571108.1.43328 WP_000571108.1.43331 WP_000571108.1.43341 WP_000571108.1.43349 WP_000571108.1.43360 WP_000571108.1.43366 WP_000571108.1.43369 WP_000571108.1.4337 WP_000571108.1.43375 WP_000571108.1.43405 WP_000571108.1.43406 WP_000571108.1.4341 WP_000571108.1.43414 WP_000571108.1.43446 WP_000571108.1.43460 WP_000571108.1.4347 WP_000571108.1.43506 WP_000571108.1.43512 WP_000571108.1.43550 WP_000571108.1.43560 WP_000571108.1.43594 WP_000571108.1.43600 WP_000571108.1.43617 WP_000571108.1.43618 WP_000571108.1.43627 WP_000571108.1.43659 WP_000571108.1.43665 WP_000571108.1.43670 WP_000571108.1.43683 WP_000571108.1.4369 WP_000571108.1.4370 WP_000571108.1.43702 WP_000571108.1.43703 WP_000571108.1.4372 WP_000571108.1.43731 WP_000571108.1.4374 WP_000571108.1.43752 WP_000571108.1.43784 WP_000571108.1.43788 WP_000571108.1.4379 WP_000571108.1.43800 WP_000571108.1.43819 WP_000571108.1.43822 WP_000571108.1.43827 WP_000571108.1.4385 WP_000571108.1.43851 WP_000571108.1.4386 WP_000571108.1.43904 WP_000571108.1.43915 WP_000571108.1.43924 WP_000571108.1.43964 WP_000571108.1.43984 WP_000571108.1.43988 WP_000571108.1.43995 WP_000571108.1.44021 WP_000571108.1.44072 WP_000571108.1.44074 WP_000571108.1.44119 WP_000571108.1.44150 WP_000571108.1.44153 WP_000571108.1.44177 WP_000571108.1.44178 WP_000571108.1.44181 WP_000571108.1.44186 WP_000571108.1.44195 WP_000571108.1.44255 WP_000571108.1.44265 WP_000571108.1.44302 WP_000571108.1.44312 WP_000571108.1.44331 WP_000571108.1.44344 WP_000571108.1.44382 WP_000571108.1.44388 WP_000571108.1.44396 WP_000571108.1.44405 WP_000571108.1.44420 WP_000571108.1.44432 WP_000571108.1.44455 WP_000571108.1.44480 WP_000571108.1.44493 WP_000571108.1.44504 WP_000571108.1.44515 WP_000571108.1.44517 WP_000571108.1.44520 WP_000571108.1.44536 WP_000571108.1.44544 WP_000571108.1.44547 WP_000571108.1.44579 WP_000571108.1.44586 WP_000571108.1.44588 WP_000571108.1.44605 WP_000571108.1.44623 WP_000571108.1.44631 WP_000571108.1.44646 WP_000571108.1.44655 WP_000571108.1.44667 WP_000571108.1.44672 WP_000571108.1.44674 WP_000571108.1.447 WP_000571108.1.44714 WP_000571108.1.44715 WP_000571108.1.44732 WP_000571108.1.44755 WP_000571108.1.44768 WP_000571108.1.44785 WP_000571108.1.44788 WP_000571108.1.44796 WP_000571108.1.44802 WP_000571108.1.44853 WP_000571108.1.44856 WP_000571108.1.44868 WP_000571108.1.44876 WP_000571108.1.44881 WP_000571108.1.44882 WP_000571108.1.44891 WP_000571108.1.44892 WP_000571108.1.44914 WP_000571108.1.44932 WP_000571108.1.44940 WP_000571108.1.44948 WP_000571108.1.44955 WP_000571108.1.44969 WP_000571108.1.4499 WP_000571108.1.44993 WP_000571108.1.45008 WP_000571108.1.45010 WP_000571108.1.45015 WP_000571108.1.45033 WP_000571108.1.45035 WP_000571108.1.45042 WP_000571108.1.45080 WP_000571108.1.45091 WP_000571108.1.45094 WP_000571108.1.45099 WP_000571108.1.45101 WP_000571108.1.45111 WP_000571108.1.45114 WP_000571108.1.45132 WP_000571108.1.45133 WP_000571108.1.45140 WP_000571108.1.45157 WP_000571108.1.45162 WP_000571108.1.45164 WP_000571108.1.45170 WP_000571108.1.45188 WP_000571108.1.45189 WP_000571108.1.45221 WP_000571108.1.45223 WP_000571108.1.45242 WP_000571108.1.45267 WP_000571108.1.4527 WP_000571108.1.45272 WP_000571108.1.45281 WP_000571108.1.45290 WP_000571108.1.45297 WP_000571108.1.453 WP_000571108.1.45303 WP_000571108.1.45321 WP_000571108.1.45332 WP_000571108.1.45364 WP_000571108.1.45431 WP_000571108.1.45439 WP_000571108.1.45447 WP_000571108.1.4545 WP_000571108.1.45450 WP_000571108.1.45456 WP_000571108.1.4546 WP_000571108.1.45472 WP_000571108.1.45492 WP_000571108.1.4550 WP_000571108.1.45507 WP_000571108.1.45542 WP_000571108.1.45555 WP_000571108.1.45560 WP_000571108.1.45574 WP_000571108.1.45577 WP_000571108.1.45610 WP_000571108.1.45620 WP_000571108.1.45640 WP_000571108.1.45645 WP_000571108.1.45654 WP_000571108.1.45670 WP_000571108.1.45705 WP_000571108.1.45713 WP_000571108.1.45730 WP_000571108.1.45734 WP_000571108.1.45747 WP_000571108.1.45763 WP_000571108.1.45768 WP_000571108.1.4577 WP_000571108.1.45771 WP_000571108.1.45773 WP_000571108.1.45780 WP_000571108.1.4580 WP_000571108.1.4582 WP_000571108.1.45822 WP_000571108.1.4584 WP_000571108.1.45852 WP_000571108.1.45859 WP_000571108.1.45862 WP_000571108.1.45870 WP_000571108.1.45874 WP_000571108.1.45875 WP_000571108.1.45878 WP_000571108.1.45881 WP_000571108.1.45888 WP_000571108.1.45897 WP_000571108.1.459 WP_000571108.1.45954 WP_000571108.1.4597 WP_000571108.1.45977 WP_000571108.1.45979 WP_000571108.1.4598 WP_000571108.1.46003 WP_000571108.1.46005 WP_000571108.1.46013 WP_000571108.1.46035 WP_000571108.1.46037 WP_000571108.1.46050 WP_000571108.1.46055 WP_000571108.1.46062 WP_000571108.1.46071 WP_000571108.1.46078 WP_000571108.1.46082 WP_000571108.1.46087 WP_000571108.1.46106 WP_000571108.1.46109 WP_000571108.1.46136 WP_000571108.1.46168 WP_000571108.1.46171 WP_000571108.1.46172 WP_000571108.1.46185 WP_000571108.1.46208 WP_000571108.1.46212 WP_000571108.1.46222 WP_000571108.1.46228 WP_000571108.1.46248 WP_000571108.1.46276 WP_000571108.1.46320 WP_000571108.1.46330 WP_000571108.1.46333 WP_000571108.1.46334 WP_000571108.1.46339 WP_000571108.1.46353 WP_000571108.1.46362 WP_000571108.1.46368 WP_000571108.1.46380 WP_000571108.1.46401 WP_000571108.1.46422 WP_000571108.1.46457 WP_000571108.1.46465 WP_000571108.1.46488 WP_000571108.1.46528 WP_000571108.1.46529 WP_000571108.1.46534 WP_000571108.1.46543 WP_000571108.1.46576 WP_000571108.1.46587 WP_000571108.1.46608 WP_000571108.1.46619 WP_000571108.1.4662 WP_000571108.1.46648 WP_000571108.1.46660 WP_000571108.1.46664 WP_000571108.1.46670 WP_000571108.1.46676 WP_000571108.1.46688 WP_000571108.1.46692 WP_000571108.1.46702 WP_000571108.1.46703 WP_000571108.1.46720 WP_000571108.1.46736 WP_000571108.1.46752 WP_000571108.1.46765 WP_000571108.1.46767 WP_000571108.1.46770 WP_000571108.1.46772 WP_000571108.1.4680 WP_000571108.1.46823 WP_000571108.1.46837 WP_000571108.1.46852 WP_000571108.1.46875 WP_000571108.1.46881 WP_000571108.1.46906 WP_000571108.1.46908 WP_000571108.1.46911 WP_000571108.1.46914 WP_000571108.1.46925 WP_000571108.1.46929 WP_000571108.1.46937 WP_000571108.1.4694 WP_000571108.1.46947 WP_000571108.1.4696 WP_000571108.1.46964 WP_000571108.1.46965 WP_000571108.1.46983 WP_000571108.1.46995 WP_000571108.1.47002 WP_000571108.1.47051 WP_000571108.1.47065 WP_000571108.1.47090 WP_000571108.1.47107 WP_000571108.1.47111 WP_000571108.1.47128 WP_000571108.1.47153 WP_000571108.1.47159 WP_000571108.1.4716 WP_000571108.1.47163 WP_000571108.1.47187 WP_000571108.1.47193 WP_000571108.1.47205 WP_000571108.1.47211 WP_000571108.1.47216 WP_000571108.1.47218 WP_000571108.1.47250 WP_000571108.1.47258 WP_000571108.1.47269 WP_000571108.1.47276 WP_000571108.1.47279 WP_000571108.1.4728 WP_000571108.1.47282 WP_000571108.1.47290 WP_000571108.1.47294 WP_000571108.1.47306 WP_000571108.1.47308 WP_000571108.1.47317 WP_000571108.1.47328 WP_000571108.1.47331 WP_000571108.1.47334 WP_000571108.1.47381 WP_000571108.1.47383 WP_000571108.1.47399 WP_000571108.1.47405 WP_000571108.1.47406 WP_000571108.1.47408 WP_000571108.1.47422 WP_000571108.1.47426 WP_000571108.1.47432 WP_000571108.1.47439 WP_000571108.1.47450 WP_000571108.1.47459 WP_000571108.1.4752 WP_000571108.1.47522 WP_000571108.1.47530 WP_000571108.1.47554 WP_000571108.1.47560 WP_000571108.1.47570 WP_000571108.1.47577 WP_000571108.1.47617 WP_000571108.1.47618 WP_000571108.1.47667 WP_000571108.1.47669 WP_000571108.1.4767 WP_000571108.1.47680 WP_000571108.1.477 WP_000571108.1.47702 WP_000571108.1.47719 WP_000571108.1.47733 WP_000571108.1.47747 WP_000571108.1.47763 WP_000571108.1.47782 WP_000571108.1.47792 WP_000571108.1.47821 WP_000571108.1.47836 WP_000571108.1.47851 WP_000571108.1.47859 WP_000571108.1.47864 WP_000571108.1.47872 WP_000571108.1.47873 WP_000571108.1.47888 WP_000571108.1.47901 WP_000571108.1.47904 WP_000571108.1.47908 WP_000571108.1.4792 WP_000571108.1.47951 WP_000571108.1.47980 WP_000571108.1.47989 WP_000571108.1.47996 WP_000571108.1.48009 WP_000571108.1.48011 WP_000571108.1.48013 WP_000571108.1.48017 WP_000571108.1.48030 WP_000571108.1.48046 WP_000571108.1.48047 WP_000571108.1.4805 WP_000571108.1.48057 WP_000571108.1.48067 WP_000571108.1.48116 WP_000571108.1.48142 WP_000571108.1.48149 WP_000571108.1.4815 WP_000571108.1.48154 WP_000571108.1.48156 WP_000571108.1.48169 WP_000571108.1.48186 WP_000571108.1.48187 WP_000571108.1.48197 WP_000571108.1.48205 WP_000571108.1.48223 WP_000571108.1.48227 WP_000571108.1.48236 WP_000571108.1.48250 WP_000571108.1.48272 WP_000571108.1.48282 WP_000571108.1.48284 WP_000571108.1.48293 WP_000571108.1.48307 WP_000571108.1.48310 WP_000571108.1.48326 WP_000571108.1.48335 WP_000571108.1.48338 WP_000571108.1.48364 WP_000571108.1.48376 WP_000571108.1.48391 WP_000571108.1.48394 WP_000571108.1.48398 WP_000571108.1.484 WP_000571108.1.4840 WP_000571108.1.48425 WP_000571108.1.48427 WP_000571108.1.48437 WP_000571108.1.48438 WP_000571108.1.48463 WP_000571108.1.48479 WP_000571108.1.48492 WP_000571108.1.4852 WP_000571108.1.48563 WP_000571108.1.48577 WP_000571108.1.48580 WP_000571108.1.48593 WP_000571108.1.48601 WP_000571108.1.48634 WP_000571108.1.48655 WP_000571108.1.48656 WP_000571108.1.48664 WP_000571108.1.48670 WP_000571108.1.4868 WP_000571108.1.48694 WP_000571108.1.48705 WP_000571108.1.48711 WP_000571108.1.48723 WP_000571108.1.48769 WP_000571108.1.48775 WP_000571108.1.48782 WP_000571108.1.48786 WP_000571108.1.48805 WP_000571108.1.48818 WP_000571108.1.48823 WP_000571108.1.48833 WP_000571108.1.48835 WP_000571108.1.48869 WP_000571108.1.48936 WP_000571108.1.48941 WP_000571108.1.48943 WP_000571108.1.48945 WP_000571108.1.48951 WP_000571108.1.48966 WP_000571108.1.48968 WP_000571108.1.48982 WP_000571108.1.48993 WP_000571108.1.48996 WP_000571108.1.4901 WP_000571108.1.49018 WP_000571108.1.4905 WP_000571108.1.49071 WP_000571108.1.49094 WP_000571108.1.49105 WP_000571108.1.49129 WP_000571108.1.49143 WP_000571108.1.49150 WP_000571108.1.49154 WP_000571108.1.49159 WP_000571108.1.4916 WP_000571108.1.49161 WP_000571108.1.4917 WP_000571108.1.49171 WP_000571108.1.49173 WP_000571108.1.4918 WP_000571108.1.49189 WP_000571108.1.49196 WP_000571108.1.49199 WP_000571108.1.4920 WP_000571108.1.49207 WP_000571108.1.4921 WP_000571108.1.49227 WP_000571108.1.49234 WP_000571108.1.4924 WP_000571108.1.49248 WP_000571108.1.49257 WP_000571108.1.49301 WP_000571108.1.49326 WP_000571108.1.49327 WP_000571108.1.49330 WP_000571108.1.49362 WP_000571108.1.49373 WP_000571108.1.49398 WP_000571108.1.49418 WP_000571108.1.4945 WP_000571108.1.49484 WP_000571108.1.4950 WP_000571108.1.49518 WP_000571108.1.49530 WP_000571108.1.49539 WP_000571108.1.49549 WP_000571108.1.49573 WP_000571108.1.49581 WP_000571108.1.49582 WP_000571108.1.496 WP_000571108.1.49603 WP_000571108.1.49605 WP_000571108.1.4962 WP_000571108.1.49643 WP_000571108.1.49653 WP_000571108.1.49658 WP_000571108.1.49669 WP_000571108.1.49671 WP_000571108.1.49672 WP_000571108.1.49690 WP_000571108.1.49704 WP_000571108.1.49707 WP_000571108.1.49715 WP_000571108.1.49730 WP_000571108.1.49732 WP_000571108.1.49742 WP_000571108.1.49745 WP_000571108.1.49757 WP_000571108.1.4980 WP_000571108.1.49800 WP_000571108.1.49819 WP_000571108.1.4982 WP_000571108.1.49825 WP_000571108.1.4984 WP_000571108.1.49860 WP_000571108.1.49863 WP_000571108.1.4987 WP_000571108.1.49871 WP_000571108.1.4989 WP_000571108.1.49894 WP_000571108.1.49907 WP_000571108.1.49912 WP_000571108.1.49913 WP_000571108.1.49917 WP_000571108.1.49918 WP_000571108.1.49934 WP_000571108.1.49935 WP_000571108.1.49936 WP_000571108.1.4994 WP_000571108.1.49943 WP_000571108.1.49951 WP_000571108.1.49970 WP_000571108.1.49982 WP_000571108.1.50013 WP_000571108.1.50015 WP_000571108.1.50023 WP_000571108.1.50028 WP_000571108.1.50038 WP_000571108.1.50039 WP_000571108.1.50061 WP_000571108.1.50064 WP_000571108.1.50071 WP_000571108.1.50076 WP_000571108.1.50117 WP_000571108.1.5013 WP_000571108.1.50138 WP_000571108.1.50145 WP_000571108.1.50175 WP_000571108.1.50178 WP_000571108.1.50192 WP_000571108.1.50212 WP_000571108.1.50217 WP_000571108.1.50219 WP_000571108.1.50229 WP_000571108.1.50261 WP_000571108.1.50291 WP_000571108.1.50313 WP_000571108.1.50314 WP_000571108.1.5035 WP_000571108.1.50356 WP_000571108.1.50360 WP_000571108.1.50367 WP_000571108.1.50369 WP_000571108.1.50377 WP_000571108.1.50388 WP_000571108.1.50424 WP_000571108.1.50425 WP_000571108.1.50430 WP_000571108.1.50431 WP_000571108.1.50440 WP_000571108.1.5045 WP_000571108.1.50464 WP_000571108.1.50516 WP_000571108.1.50525 WP_000571108.1.50527 WP_000571108.1.50536 WP_000571108.1.50543 WP_000571108.1.50555 WP_000571108.1.50558 WP_000571108.1.50568 WP_000571108.1.50578 WP_000571108.1.5059 WP_000571108.1.50594 WP_000571108.1.50595 WP_000571108.1.50647 WP_000571108.1.50660 WP_000571108.1.50669 WP_000571108.1.50699 WP_000571108.1.50711 WP_000571108.1.50732 WP_000571108.1.50740 WP_000571108.1.50742 WP_000571108.1.50745 WP_000571108.1.50748 WP_000571108.1.50759 WP_000571108.1.50768 WP_000571108.1.50799 WP_000571108.1.5080 WP_000571108.1.50817 WP_000571108.1.50820 WP_000571108.1.50827 WP_000571108.1.50829 WP_000571108.1.50884 WP_000571108.1.50896 WP_000571108.1.50937 WP_000571108.1.50958 WP_000571108.1.50962 WP_000571108.1.50974 WP_000571108.1.51008 WP_000571108.1.51015 WP_000571108.1.51031 WP_000571108.1.51062 WP_000571108.1.5108 WP_000571108.1.51085 WP_000571108.1.5109 WP_000571108.1.5110 WP_000571108.1.5111 WP_000571108.1.51130 WP_000571108.1.51138 WP_000571108.1.51152 WP_000571108.1.5117 WP_000571108.1.51194 WP_000571108.1.51209 WP_000571108.1.51226 WP_000571108.1.51236 WP_000571108.1.51245 WP_000571108.1.51250 WP_000571108.1.51271 WP_000571108.1.51277 WP_000571108.1.51282 WP_000571108.1.51295 WP_000571108.1.51306 WP_000571108.1.51310 WP_000571108.1.51326 WP_000571108.1.51346 WP_000571108.1.51365 WP_000571108.1.51376 WP_000571108.1.51377 WP_000571108.1.51393 WP_000571108.1.51403 WP_000571108.1.51418 WP_000571108.1.5145 WP_000571108.1.51454 WP_000571108.1.51456 WP_000571108.1.51469 WP_000571108.1.51492 WP_000571108.1.51496 WP_000571108.1.515 WP_000571108.1.51527 WP_000571108.1.5155 WP_000571108.1.51557 WP_000571108.1.51558 WP_000571108.1.51559 WP_000571108.1.51575 WP_000571108.1.51590 WP_000571108.1.51619 WP_000571108.1.51623 WP_000571108.1.51657 WP_000571108.1.51665 WP_000571108.1.51702 WP_000571108.1.51713 WP_000571108.1.51716 WP_000571108.1.51741 WP_000571108.1.51748 WP_000571108.1.51751 WP_000571108.1.51787 WP_000571108.1.51794 WP_000571108.1.51797 WP_000571108.1.51812 WP_000571108.1.51824 WP_000571108.1.51836 WP_000571108.1.51842 WP_000571108.1.51844 WP_000571108.1.51866 WP_000571108.1.51871 WP_000571108.1.51883 WP_000571108.1.5190 WP_000571108.1.51920 WP_000571108.1.51924 WP_000571108.1.51936 WP_000571108.1.51952 WP_000571108.1.51971 WP_000571108.1.51973 WP_000571108.1.51995 WP_000571108.1.52034 WP_000571108.1.52061 WP_000571108.1.52072 WP_000571108.1.52078 WP_000571108.1.5209 WP_000571108.1.521 WP_000571108.1.5213 WP_000571108.1.52151 WP_000571108.1.52162 WP_000571108.1.52182 WP_000571108.1.52185 WP_000571108.1.52193 WP_000571108.1.52195 WP_000571108.1.52198 WP_000571108.1.52210 WP_000571108.1.52224 WP_000571108.1.52251 WP_000571108.1.52252 WP_000571108.1.52259 WP_000571108.1.5228 WP_000571108.1.52289 WP_000571108.1.52296 WP_000571108.1.523 WP_000571108.1.52308 WP_000571108.1.5231 WP_000571108.1.52322 WP_000571108.1.52327 WP_000571108.1.52331 WP_000571108.1.52340 WP_000571108.1.52343 WP_000571108.1.52377 WP_000571108.1.52396 WP_000571108.1.52427 WP_000571108.1.52436 WP_000571108.1.52440 WP_000571108.1.52442 WP_000571108.1.52452 WP_000571108.1.52463 WP_000571108.1.52474 WP_000571108.1.5251 WP_000571108.1.52511 WP_000571108.1.52518 WP_000571108.1.52536 WP_000571108.1.52548 WP_000571108.1.52595 WP_000571108.1.52602 WP_000571108.1.52605 WP_000571108.1.52622 WP_000571108.1.52623 WP_000571108.1.52624 WP_000571108.1.52645 WP_000571108.1.52660 WP_000571108.1.52687 WP_000571108.1.52699 WP_000571108.1.52715 WP_000571108.1.52722 WP_000571108.1.52751 WP_000571108.1.52754 WP_000571108.1.52772 WP_000571108.1.52820 WP_000571108.1.52828 WP_000571108.1.52830 WP_000571108.1.52836 WP_000571108.1.52838 WP_000571108.1.52848 WP_000571108.1.52865 WP_000571108.1.52877 WP_000571108.1.52878 WP_000571108.1.52886 WP_000571108.1.52889 WP_000571108.1.52893 WP_000571108.1.52900 WP_000571108.1.52904 WP_000571108.1.52941 WP_000571108.1.52947 WP_000571108.1.52965 WP_000571108.1.52983 WP_000571108.1.52984 WP_000571108.1.52992 WP_000571108.1.53002 WP_000571108.1.53007 WP_000571108.1.53022 WP_000571108.1.5304 WP_000571108.1.53050 WP_000571108.1.53057 WP_000571108.1.53060 WP_000571108.1.53069 WP_000571108.1.53071 WP_000571108.1.53077 WP_000571108.1.53109 WP_000571108.1.53140 WP_000571108.1.53153 WP_000571108.1.53178 WP_000571108.1.53189 WP_000571108.1.5319 WP_000571108.1.53209 WP_000571108.1.53245 WP_000571108.1.53260 WP_000571108.1.53285 WP_000571108.1.53312 WP_000571108.1.53317 WP_000571108.1.53319 WP_000571108.1.5336 WP_000571108.1.53363 WP_000571108.1.53366 WP_000571108.1.53373 WP_000571108.1.53379 WP_000571108.1.53383 WP_000571108.1.53387 WP_000571108.1.53394 WP_000571108.1.53403 WP_000571108.1.53408 WP_000571108.1.53432 WP_000571108.1.53433 WP_000571108.1.53444 WP_000571108.1.53452 WP_000571108.1.53462 WP_000571108.1.53467 WP_000571108.1.5347 WP_000571108.1.53521 WP_000571108.1.53532 WP_000571108.1.53577 WP_000571108.1.53641 WP_000571108.1.53648 WP_000571108.1.53661 WP_000571108.1.53671 WP_000571108.1.53682 WP_000571108.1.53712 WP_000571108.1.53714 WP_000571108.1.53758 WP_000571108.1.53763 WP_000571108.1.53766 WP_000571108.1.53774 WP_000571108.1.53786 WP_000571108.1.53799 WP_000571108.1.5382 WP_000571108.1.53827 WP_000571108.1.53835 WP_000571108.1.53886 WP_000571108.1.53889 WP_000571108.1.53911 WP_000571108.1.53915 WP_000571108.1.53924 WP_000571108.1.53926 WP_000571108.1.53934 WP_000571108.1.53969 WP_000571108.1.53999 WP_000571108.1.5401 WP_000571108.1.54022 WP_000571108.1.54029 WP_000571108.1.54048 WP_000571108.1.54049 WP_000571108.1.54074 WP_000571108.1.54086 WP_000571108.1.54105 WP_000571108.1.54109 WP_000571108.1.54135 WP_000571108.1.54147 WP_000571108.1.54161 WP_000571108.1.54199 WP_000571108.1.54229 WP_000571108.1.54237 WP_000571108.1.54246 WP_000571108.1.54253 WP_000571108.1.54269 WP_000571108.1.54282 WP_000571108.1.54290 WP_000571108.1.54297 WP_000571108.1.54299 WP_000571108.1.54332 WP_000571108.1.54373 WP_000571108.1.544 WP_000571108.1.54404 WP_000571108.1.54413 WP_000571108.1.54426 WP_000571108.1.54438 WP_000571108.1.54471 WP_000571108.1.54477 WP_000571108.1.54479 WP_000571108.1.54485 WP_000571108.1.54503 WP_000571108.1.54510 WP_000571108.1.54518 WP_000571108.1.54539 WP_000571108.1.54543 WP_000571108.1.54551 WP_000571108.1.54554 WP_000571108.1.54572 WP_000571108.1.54574 WP_000571108.1.54637 WP_000571108.1.54675 WP_000571108.1.54689 WP_000571108.1.5469 WP_000571108.1.54733 WP_000571108.1.54744 WP_000571108.1.54745 WP_000571108.1.54753 WP_000571108.1.54819 WP_000571108.1.54826 WP_000571108.1.54830 WP_000571108.1.54847 WP_000571108.1.54878 WP_000571108.1.54895 WP_000571108.1.54914 WP_000571108.1.54929 WP_000571108.1.54931 WP_000571108.1.54955 WP_000571108.1.54967 WP_000571108.1.54990 WP_000571108.1.54995 WP_000571108.1.5500 WP_000571108.1.55004 WP_000571108.1.55014 WP_000571108.1.55082 WP_000571108.1.55084 WP_000571108.1.55090 WP_000571108.1.55095 WP_000571108.1.55100 WP_000571108.1.5518 WP_000571108.1.5519 WP_000571108.1.55192 WP_000571108.1.552 WP_000571108.1.55214 WP_000571108.1.55220 WP_000571108.1.55239 WP_000571108.1.55271 WP_000571108.1.55272 WP_000571108.1.55274 WP_000571108.1.55301 WP_000571108.1.55306 WP_000571108.1.55309 WP_000571108.1.55327 WP_000571108.1.55352 WP_000571108.1.5536 WP_000571108.1.55367 WP_000571108.1.55369 WP_000571108.1.55403 WP_000571108.1.55405 WP_000571108.1.55419 WP_000571108.1.55421 WP_000571108.1.55442 WP_000571108.1.55495 WP_000571108.1.5550 WP_000571108.1.55508 WP_000571108.1.55527 WP_000571108.1.55535 WP_000571108.1.55538 WP_000571108.1.5554 WP_000571108.1.55544 WP_000571108.1.55558 WP_000571108.1.5556 WP_000571108.1.55573 WP_000571108.1.55583 WP_000571108.1.5559 WP_000571108.1.55603 WP_000571108.1.5562 WP_000571108.1.55620 WP_000571108.1.55628 WP_000571108.1.55637 WP_000571108.1.5565 WP_000571108.1.55653 WP_000571108.1.557 WP_000571108.1.55719 WP_000571108.1.55724 WP_000571108.1.55728 WP_000571108.1.55746 WP_000571108.1.5575 WP_000571108.1.55786 WP_000571108.1.5580 WP_000571108.1.55818 WP_000571108.1.55831 WP_000571108.1.55835 WP_000571108.1.55839 WP_000571108.1.55845 WP_000571108.1.55848 WP_000571108.1.55854 WP_000571108.1.55859 WP_000571108.1.55867 WP_000571108.1.55886 WP_000571108.1.5589 WP_000571108.1.5590 WP_000571108.1.55904 WP_000571108.1.55916 WP_000571108.1.55933 WP_000571108.1.55949 WP_000571108.1.55953 WP_000571108.1.55955 WP_000571108.1.55991 WP_000571108.1.56000 WP_000571108.1.56003 WP_000571108.1.56025 WP_000571108.1.56039 WP_000571108.1.5604 WP_000571108.1.56048 WP_000571108.1.5606 WP_000571108.1.56064 WP_000571108.1.56078 WP_000571108.1.56098 WP_000571108.1.56099 WP_000571108.1.56106 WP_000571108.1.56135 WP_000571108.1.56153 WP_000571108.1.56159 WP_000571108.1.56200 WP_000571108.1.56210 WP_000571108.1.56213 WP_000571108.1.56214 WP_000571108.1.56220 WP_000571108.1.56225 WP_000571108.1.5623 WP_000571108.1.56237 WP_000571108.1.56239 WP_000571108.1.56241 WP_000571108.1.56265 WP_000571108.1.56272 WP_000571108.1.56275 WP_000571108.1.56281 WP_000571108.1.56306 WP_000571108.1.56332 WP_000571108.1.56333 WP_000571108.1.56343 WP_000571108.1.5635 WP_000571108.1.56364 WP_000571108.1.5637 WP_000571108.1.56377 WP_000571108.1.56387 WP_000571108.1.56400 WP_000571108.1.5644 WP_000571108.1.56444 WP_000571108.1.56453 WP_000571108.1.56464 WP_000571108.1.56482 WP_000571108.1.56496 WP_000571108.1.56522 WP_000571108.1.56525 WP_000571108.1.56542 WP_000571108.1.56558 WP_000571108.1.56570 WP_000571108.1.5658 WP_000571108.1.56584 WP_000571108.1.56598 WP_000571108.1.566 WP_000571108.1.56608 WP_000571108.1.56619 WP_000571108.1.56628 WP_000571108.1.56641 WP_000571108.1.5665 WP_000571108.1.56658 WP_000571108.1.5666 WP_000571108.1.56679 WP_000571108.1.56696 WP_000571108.1.56702 WP_000571108.1.56708 WP_000571108.1.56722 WP_000571108.1.56723 WP_000571108.1.56737 WP_000571108.1.5677 WP_000571108.1.56772 WP_000571108.1.56778 WP_000571108.1.56779 WP_000571108.1.56794 WP_000571108.1.56803 WP_000571108.1.56806 WP_000571108.1.56815 WP_000571108.1.56822 WP_000571108.1.56856 WP_000571108.1.5686 WP_000571108.1.56865 WP_000571108.1.56878 WP_000571108.1.569 WP_000571108.1.56903 WP_000571108.1.56931 WP_000571108.1.56966 WP_000571108.1.56967 WP_000571108.1.56975 WP_000571108.1.56986 WP_000571108.1.57015 WP_000571108.1.57024 WP_000571108.1.57047 WP_000571108.1.5705 WP_000571108.1.57073 WP_000571108.1.57075 WP_000571108.1.57081 WP_000571108.1.57097 WP_000571108.1.57102 WP_000571108.1.57109 WP_000571108.1.57115 WP_000571108.1.57141 WP_000571108.1.57158 WP_000571108.1.57170 WP_000571108.1.57175 WP_000571108.1.5718 WP_000571108.1.57190 WP_000571108.1.57214 WP_000571108.1.57223 WP_000571108.1.57265 WP_000571108.1.57271 WP_000571108.1.57291 WP_000571108.1.57309 WP_000571108.1.57316 WP_000571108.1.57330 WP_000571108.1.5735 WP_000571108.1.57370 WP_000571108.1.57376 WP_000571108.1.57385 WP_000571108.1.57427 WP_000571108.1.5743 WP_000571108.1.57445 WP_000571108.1.57448 WP_000571108.1.57481 WP_000571108.1.5749 WP_000571108.1.57507 WP_000571108.1.5752 WP_000571108.1.57593 WP_000571108.1.57612 WP_000571108.1.57614 WP_000571108.1.5763 WP_000571108.1.57635 WP_000571108.1.57650 WP_000571108.1.57665 WP_000571108.1.57670 WP_000571108.1.57682 WP_000571108.1.57692 WP_000571108.1.57693 WP_000571108.1.5770 WP_000571108.1.57701 WP_000571108.1.57718 WP_000571108.1.57720 WP_000571108.1.57727 WP_000571108.1.57730 WP_000571108.1.57734 WP_000571108.1.57745 WP_000571108.1.57754 WP_000571108.1.57761 WP_000571108.1.57770 WP_000571108.1.57783 WP_000571108.1.57808 WP_000571108.1.57819 WP_000571108.1.57837 WP_000571108.1.57840 WP_000571108.1.57844 WP_000571108.1.57861 WP_000571108.1.57875 WP_000571108.1.57878 WP_000571108.1.57883 WP_000571108.1.57888 WP_000571108.1.579 WP_000571108.1.5791 WP_000571108.1.57910 WP_000571108.1.57915 WP_000571108.1.57928 WP_000571108.1.57943 WP_000571108.1.57944 WP_000571108.1.57952 WP_000571108.1.57962 WP_000571108.1.57974 WP_000571108.1.5799 WP_000571108.1.58005 WP_000571108.1.58006 WP_000571108.1.58014 WP_000571108.1.58016 WP_000571108.1.58017 WP_000571108.1.58042 WP_000571108.1.58049 WP_000571108.1.58050 WP_000571108.1.58051 WP_000571108.1.58074 WP_000571108.1.58106 WP_000571108.1.58116 WP_000571108.1.58122 WP_000571108.1.58127 WP_000571108.1.58139 WP_000571108.1.58148 WP_000571108.1.58158 WP_000571108.1.5816 WP_000571108.1.5817 WP_000571108.1.58175 WP_000571108.1.58185 WP_000571108.1.58198 WP_000571108.1.58212 WP_000571108.1.58241 WP_000571108.1.58242 WP_000571108.1.58246 WP_000571108.1.5827 WP_000571108.1.58277 WP_000571108.1.58317 WP_000571108.1.5832 WP_000571108.1.58325 WP_000571108.1.58350 WP_000571108.1.58352 WP_000571108.1.58353 WP_000571108.1.58364 WP_000571108.1.58366 WP_000571108.1.58373 WP_000571108.1.58388 WP_000571108.1.58392 WP_000571108.1.58395 WP_000571108.1.58413 WP_000571108.1.58421 WP_000571108.1.58430 WP_000571108.1.58435 WP_000571108.1.58473 WP_000571108.1.58481 WP_000571108.1.5849 WP_000571108.1.58495 WP_000571108.1.58504 WP_000571108.1.58508 WP_000571108.1.58512 WP_000571108.1.58521 WP_000571108.1.58530 WP_000571108.1.58549 WP_000571108.1.5857 WP_000571108.1.58571 WP_000571108.1.58584 WP_000571108.1.58588 WP_000571108.1.58592 WP_000571108.1.58598 WP_000571108.1.586 WP_000571108.1.58603 WP_000571108.1.58626 WP_000571108.1.58701 WP_000571108.1.58704 WP_000571108.1.58714 WP_000571108.1.58718 WP_000571108.1.58735 WP_000571108.1.58760 WP_000571108.1.58763 WP_000571108.1.58772 WP_000571108.1.58775 WP_000571108.1.58798 WP_000571108.1.5880 WP_000571108.1.58833 WP_000571108.1.58839 WP_000571108.1.58860 WP_000571108.1.58934 WP_000571108.1.58936 WP_000571108.1.58960 WP_000571108.1.58981 WP_000571108.1.58991 WP_000571108.1.58998 WP_000571108.1.5901 WP_000571108.1.59011 WP_000571108.1.59014 WP_000571108.1.59039 WP_000571108.1.5904 WP_000571108.1.59046 WP_000571108.1.59077 WP_000571108.1.59098 WP_000571108.1.59124 WP_000571108.1.59133 WP_000571108.1.59135 WP_000571108.1.59146 WP_000571108.1.59157 WP_000571108.1.59175 WP_000571108.1.59178 WP_000571108.1.5920 WP_000571108.1.59203 WP_000571108.1.59213 WP_000571108.1.5925 WP_000571108.1.59269 WP_000571108.1.59284 WP_000571108.1.5930 WP_000571108.1.59311 WP_000571108.1.59327 WP_000571108.1.59334 WP_000571108.1.59337 WP_000571108.1.59363 WP_000571108.1.59397 WP_000571108.1.59398 WP_000571108.1.5940 WP_000571108.1.59401 WP_000571108.1.59404 WP_000571108.1.59414 WP_000571108.1.59441 WP_000571108.1.59457 WP_000571108.1.59459 WP_000571108.1.59462 WP_000571108.1.59464 WP_000571108.1.59467 WP_000571108.1.59478 WP_000571108.1.59489 WP_000571108.1.59498 WP_000571108.1.59540 WP_000571108.1.59546 WP_000571108.1.59547 WP_000571108.1.59567 WP_000571108.1.59594 WP_000571108.1.59598 WP_000571108.1.59603 WP_000571108.1.59609 WP_000571108.1.59624 WP_000571108.1.59629 WP_000571108.1.59663 WP_000571108.1.59668 WP_000571108.1.59669 WP_000571108.1.59671 WP_000571108.1.59697 WP_000571108.1.5972 WP_000571108.1.59736 WP_000571108.1.59787 WP_000571108.1.59803 WP_000571108.1.59810 WP_000571108.1.59819 WP_000571108.1.5982 WP_000571108.1.59822 WP_000571108.1.59864 WP_000571108.1.59874 WP_000571108.1.59881 WP_000571108.1.59886 WP_000571108.1.59896 WP_000571108.1.59907 WP_000571108.1.59915 WP_000571108.1.59945 WP_000571108.1.59977 WP_000571108.1.60001 WP_000571108.1.60006 WP_000571108.1.60022 WP_000571108.1.6006 WP_000571108.1.60086 WP_000571108.1.60107 WP_000571108.1.6011 WP_000571108.1.60118 WP_000571108.1.60123 WP_000571108.1.60124 WP_000571108.1.60147 WP_000571108.1.60149 WP_000571108.1.60156 WP_000571108.1.60157 WP_000571108.1.60158 WP_000571108.1.60165 WP_000571108.1.6017 WP_000571108.1.60181 WP_000571108.1.602 WP_000571108.1.60227 WP_000571108.1.60251 WP_000571108.1.60259 WP_000571108.1.60280 WP_000571108.1.60289 WP_000571108.1.60302 WP_000571108.1.60307 WP_000571108.1.60339 WP_000571108.1.6034 WP_000571108.1.60345 WP_000571108.1.60353 WP_000571108.1.60355 WP_000571108.1.60360 WP_000571108.1.60368 WP_000571108.1.60382 WP_000571108.1.60414 WP_000571108.1.60434 WP_000571108.1.6045 WP_000571108.1.60462 WP_000571108.1.60473 WP_000571108.1.60492 WP_000571108.1.60493 WP_000571108.1.60515 WP_000571108.1.60530 WP_000571108.1.60547 WP_000571108.1.60551 WP_000571108.1.60585 WP_000571108.1.60594 WP_000571108.1.60595 WP_000571108.1.60636 WP_000571108.1.60641 WP_000571108.1.60675 WP_000571108.1.60677 WP_000571108.1.60690 WP_000571108.1.60696 WP_000571108.1.60704 WP_000571108.1.60719 WP_000571108.1.60730 WP_000571108.1.60734 WP_000571108.1.60742 WP_000571108.1.60750 WP_000571108.1.60751 WP_000571108.1.60758 WP_000571108.1.60759 WP_000571108.1.60778 WP_000571108.1.60787 WP_000571108.1.60813 WP_000571108.1.60820 WP_000571108.1.60845 WP_000571108.1.6085 WP_000571108.1.60859 WP_000571108.1.60869 WP_000571108.1.60888 WP_000571108.1.60898 WP_000571108.1.60912 WP_000571108.1.60923 WP_000571108.1.60934 WP_000571108.1.60939 WP_000571108.1.60943 WP_000571108.1.60948 WP_000571108.1.60965 WP_000571108.1.60981 WP_000571108.1.60982 WP_000571108.1.60991 WP_000571108.1.61013 WP_000571108.1.61019 WP_000571108.1.61023 WP_000571108.1.61026 WP_000571108.1.61029 WP_000571108.1.61030 WP_000571108.1.61031 WP_000571108.1.61077 WP_000571108.1.61082 WP_000571108.1.61107 WP_000571108.1.61115 WP_000571108.1.61119 WP_000571108.1.61139 WP_000571108.1.61152 WP_000571108.1.61153 WP_000571108.1.6118 WP_000571108.1.61187 WP_000571108.1.61188 WP_000571108.1.61189 WP_000571108.1.6119 WP_000571108.1.61215 WP_000571108.1.6123 WP_000571108.1.61257 WP_000571108.1.61261 WP_000571108.1.61263 WP_000571108.1.61271 WP_000571108.1.61277 WP_000571108.1.61286 WP_000571108.1.61289 WP_000571108.1.61313 WP_000571108.1.61316 WP_000571108.1.61318 WP_000571108.1.61324 WP_000571108.1.61339 WP_000571108.1.61346 WP_000571108.1.61353 WP_000571108.1.6136 WP_000571108.1.61375 WP_000571108.1.61393 WP_000571108.1.61408 WP_000571108.1.61413 WP_000571108.1.61421 WP_000571108.1.61430 WP_000571108.1.61439 WP_000571108.1.61440 WP_000571108.1.6149 WP_000571108.1.61515 WP_000571108.1.61534 WP_000571108.1.61547 WP_000571108.1.61555 WP_000571108.1.61564 WP_000571108.1.61585 WP_000571108.1.61591 WP_000571108.1.61597 WP_000571108.1.61615 WP_000571108.1.61639 WP_000571108.1.61641 WP_000571108.1.61653 WP_000571108.1.6166 WP_000571108.1.61687 WP_000571108.1.6170 WP_000571108.1.61705 WP_000571108.1.61709 WP_000571108.1.61713 WP_000571108.1.61747 WP_000571108.1.61749 WP_000571108.1.61776 WP_000571108.1.61784 WP_000571108.1.61800 WP_000571108.1.61802 WP_000571108.1.61838 WP_000571108.1.61843 WP_000571108.1.61864 WP_000571108.1.6188 WP_000571108.1.6189 WP_000571108.1.61899 WP_000571108.1.619 WP_000571108.1.61903 WP_000571108.1.61910 WP_000571108.1.61921 WP_000571108.1.61936 WP_000571108.1.61962 WP_000571108.1.61970 WP_000571108.1.61975 WP_000571108.1.61976 WP_000571108.1.61978 WP_000571108.1.62002 WP_000571108.1.6201 WP_000571108.1.62028 WP_000571108.1.62030 WP_000571108.1.62069 WP_000571108.1.62071 WP_000571108.1.6208 WP_000571108.1.62088 WP_000571108.1.62093 WP_000571108.1.62096 WP_000571108.1.62127 WP_000571108.1.62140 WP_000571108.1.62160 WP_000571108.1.62164 WP_000571108.1.62229 WP_000571108.1.62247 WP_000571108.1.62253 WP_000571108.1.62254 WP_000571108.1.62265 WP_000571108.1.62318 WP_000571108.1.62346 WP_000571108.1.62352 WP_000571108.1.62367 WP_000571108.1.62382 WP_000571108.1.62383 WP_000571108.1.62392 WP_000571108.1.62398 WP_000571108.1.62409 WP_000571108.1.62414 WP_000571108.1.62416 WP_000571108.1.62429 WP_000571108.1.62437 WP_000571108.1.62453 WP_000571108.1.62459 WP_000571108.1.62462 WP_000571108.1.62474 WP_000571108.1.62482 WP_000571108.1.62492 WP_000571108.1.62496 WP_000571108.1.6250 WP_000571108.1.62537 WP_000571108.1.62539 WP_000571108.1.62553 WP_000571108.1.62563 WP_000571108.1.62575 WP_000571108.1.62602 WP_000571108.1.62608 WP_000571108.1.62621 WP_000571108.1.62625 WP_000571108.1.62653 WP_000571108.1.6266 WP_000571108.1.62671 WP_000571108.1.62674 WP_000571108.1.6268 WP_000571108.1.62684 WP_000571108.1.62685 WP_000571108.1.62740 WP_000571108.1.62756 WP_000571108.1.62764 WP_000571108.1.62771 WP_000571108.1.62781 WP_000571108.1.62796 WP_000571108.1.62808 WP_000571108.1.62822 WP_000571108.1.62824 WP_000571108.1.62829 WP_000571108.1.62831 WP_000571108.1.62842 WP_000571108.1.62860 WP_000571108.1.62863 WP_000571108.1.62878 WP_000571108.1.62880 WP_000571108.1.62925 WP_000571108.1.62927 WP_000571108.1.62956 WP_000571108.1.62970 WP_000571108.1.62974 WP_000571108.1.6298 WP_000571108.1.62998 WP_000571108.1.63003 WP_000571108.1.63011 WP_000571108.1.63021 WP_000571108.1.63027 WP_000571108.1.63040 WP_000571108.1.63047 WP_000571108.1.63050 WP_000571108.1.63051 WP_000571108.1.63052 WP_000571108.1.63068 WP_000571108.1.63070 WP_000571108.1.63083 WP_000571108.1.63085 WP_000571108.1.631 WP_000571108.1.63107 WP_000571108.1.63120 WP_000571108.1.63131 WP_000571108.1.63132 WP_000571108.1.63139 WP_000571108.1.63140 WP_000571108.1.63142 WP_000571108.1.63143 WP_000571108.1.63162 WP_000571108.1.63182 WP_000571108.1.63190 WP_000571108.1.63195 WP_000571108.1.63215 WP_000571108.1.63220 WP_000571108.1.63228 WP_000571108.1.63233 WP_000571108.1.63244 WP_000571108.1.63255 WP_000571108.1.63266 WP_000571108.1.63273 WP_000571108.1.63279 WP_000571108.1.63280 WP_000571108.1.63288 WP_000571108.1.63289 WP_000571108.1.63296 WP_000571108.1.63304 WP_000571108.1.63307 WP_000571108.1.63313 WP_000571108.1.63319 WP_000571108.1.63322 WP_000571108.1.63324 WP_000571108.1.63333 WP_000571108.1.63335 WP_000571108.1.63337 WP_000571108.1.63341 WP_000571108.1.63364 WP_000571108.1.63365 WP_000571108.1.63383 WP_000571108.1.634 WP_000571108.1.63406 WP_000571108.1.63411 WP_000571108.1.63421 WP_000571108.1.63441 WP_000571108.1.63460 WP_000571108.1.63469 WP_000571108.1.63471 WP_000571108.1.63510 WP_000571108.1.63527 WP_000571108.1.63540 WP_000571108.1.6355 WP_000571108.1.63565 WP_000571108.1.63589 WP_000571108.1.63617 WP_000571108.1.63635 WP_000571108.1.63672 WP_000571108.1.63673 WP_000571108.1.63678 WP_000571108.1.63693 WP_000571108.1.63704 WP_000571108.1.63705 WP_000571108.1.63726 WP_000571108.1.63729 WP_000571108.1.6374 WP_000571108.1.63751 WP_000571108.1.63759 WP_000571108.1.63760 WP_000571108.1.63763 WP_000571108.1.63774 WP_000571108.1.6378 WP_000571108.1.63828 WP_000571108.1.63847 WP_000571108.1.63874 WP_000571108.1.6388 WP_000571108.1.63890 WP_000571108.1.63894 WP_000571108.1.63895 WP_000571108.1.63907 WP_000571108.1.63910 WP_000571108.1.63923 WP_000571108.1.63937 WP_000571108.1.63947 WP_000571108.1.63978 WP_000571108.1.63987 WP_000571108.1.63998 WP_000571108.1.64012 WP_000571108.1.6403 WP_000571108.1.64060 WP_000571108.1.6408 WP_000571108.1.64094 WP_000571108.1.64105 WP_000571108.1.64108 WP_000571108.1.6412 WP_000571108.1.64181 WP_000571108.1.64192 WP_000571108.1.642 WP_000571108.1.64207 WP_000571108.1.64230 WP_000571108.1.64232 WP_000571108.1.64234 WP_000571108.1.64250 WP_000571108.1.64251 WP_000571108.1.64279 WP_000571108.1.64288 WP_000571108.1.64303 WP_000571108.1.64334 WP_000571108.1.64351 WP_000571108.1.64367 WP_000571108.1.64368 WP_000571108.1.6438 WP_000571108.1.64396 WP_000571108.1.64397 WP_000571108.1.64400 WP_000571108.1.64408 WP_000571108.1.64434 WP_000571108.1.64446 WP_000571108.1.64456 WP_000571108.1.64457 WP_000571108.1.64473 WP_000571108.1.645 WP_000571108.1.64525 WP_000571108.1.6453 WP_000571108.1.64537 WP_000571108.1.64565 WP_000571108.1.64583 WP_000571108.1.6459 WP_000571108.1.64598 WP_000571108.1.6462 WP_000571108.1.64628 WP_000571108.1.64630 WP_000571108.1.64643 WP_000571108.1.64665 WP_000571108.1.64677 WP_000571108.1.64686 WP_000571108.1.64720 WP_000571108.1.64765 WP_000571108.1.6479 WP_000571108.1.64811 WP_000571108.1.64845 WP_000571108.1.64858 WP_000571108.1.64860 WP_000571108.1.64873 WP_000571108.1.64879 WP_000571108.1.6488 WP_000571108.1.64893 WP_000571108.1.64896 WP_000571108.1.64897 WP_000571108.1.64899 WP_000571108.1.64911 WP_000571108.1.64928 WP_000571108.1.64935 WP_000571108.1.64951 WP_000571108.1.64961 WP_000571108.1.64988 WP_000571108.1.64996 WP_000571108.1.64998 WP_000571108.1.65025 WP_000571108.1.65033 WP_000571108.1.65038 WP_000571108.1.65044 WP_000571108.1.65076 WP_000571108.1.65082 WP_000571108.1.6509 WP_000571108.1.65125 WP_000571108.1.65132 WP_000571108.1.65156 WP_000571108.1.65158 WP_000571108.1.65164 WP_000571108.1.65180 WP_000571108.1.65193 WP_000571108.1.65203 WP_000571108.1.65214 WP_000571108.1.65217 WP_000571108.1.65233 WP_000571108.1.65243 WP_000571108.1.65259 WP_000571108.1.65264 WP_000571108.1.65274 WP_000571108.1.6531 WP_000571108.1.65317 WP_000571108.1.65346 WP_000571108.1.65358 WP_000571108.1.65361 WP_000571108.1.65367 WP_000571108.1.65387 WP_000571108.1.65406 WP_000571108.1.65407 WP_000571108.1.65419 WP_000571108.1.65423 WP_000571108.1.65432 WP_000571108.1.6544 WP_000571108.1.65443 WP_000571108.1.65448 WP_000571108.1.65451 WP_000571108.1.6547 WP_000571108.1.65470 WP_000571108.1.65504 WP_000571108.1.6551 WP_000571108.1.65512 WP_000571108.1.65520 WP_000571108.1.65541 WP_000571108.1.65544 WP_000571108.1.65555 WP_000571108.1.65562 WP_000571108.1.6559 WP_000571108.1.65599 WP_000571108.1.65616 WP_000571108.1.65629 WP_000571108.1.65643 WP_000571108.1.65653 WP_000571108.1.65656 WP_000571108.1.65663 WP_000571108.1.65675 WP_000571108.1.6568 WP_000571108.1.65689 WP_000571108.1.65693 WP_000571108.1.65700 WP_000571108.1.65703 WP_000571108.1.65704 WP_000571108.1.65705 WP_000571108.1.65713 WP_000571108.1.65717 WP_000571108.1.65734 WP_000571108.1.65750 WP_000571108.1.65752 WP_000571108.1.65769 WP_000571108.1.6578 WP_000571108.1.65808 WP_000571108.1.65809 WP_000571108.1.65842 WP_000571108.1.6585 WP_000571108.1.65856 WP_000571108.1.65870 WP_000571108.1.65879 WP_000571108.1.65892 WP_000571108.1.65922 WP_000571108.1.65928 WP_000571108.1.65930 WP_000571108.1.65931 WP_000571108.1.65935 WP_000571108.1.65946 WP_000571108.1.65947 WP_000571108.1.65948 WP_000571108.1.65965 WP_000571108.1.65986 WP_000571108.1.65990 WP_000571108.1.66009 WP_000571108.1.66014 WP_000571108.1.6603 WP_000571108.1.66035 WP_000571108.1.66054 WP_000571108.1.66069 WP_000571108.1.66073 WP_000571108.1.66081 WP_000571108.1.661 WP_000571108.1.66120 WP_000571108.1.66130 WP_000571108.1.66133 WP_000571108.1.66144 WP_000571108.1.66175 WP_000571108.1.66227 WP_000571108.1.66262 WP_000571108.1.66265 WP_000571108.1.66281 WP_000571108.1.66287 WP_000571108.1.66298 WP_000571108.1.66302 WP_000571108.1.6632 WP_000571108.1.66322 WP_000571108.1.66328 WP_000571108.1.66366 WP_000571108.1.66369 WP_000571108.1.66433 WP_000571108.1.66453 WP_000571108.1.66482 WP_000571108.1.66505 WP_000571108.1.66513 WP_000571108.1.66518 WP_000571108.1.66519 WP_000571108.1.66542 WP_000571108.1.66554 WP_000571108.1.66556 WP_000571108.1.66564 WP_000571108.1.66576 WP_000571108.1.66588 WP_000571108.1.66598 WP_000571108.1.66601 WP_000571108.1.66606 WP_000571108.1.66611 WP_000571108.1.66614 WP_000571108.1.66628 WP_000571108.1.66645 WP_000571108.1.66655 WP_000571108.1.66664 WP_000571108.1.66677 WP_000571108.1.6668 WP_000571108.1.66690 WP_000571108.1.66705 WP_000571108.1.66711 WP_000571108.1.66712 WP_000571108.1.6674 WP_000571108.1.66756 WP_000571108.1.66765 WP_000571108.1.66766 WP_000571108.1.66786 WP_000571108.1.66792 WP_000571108.1.66803 WP_000571108.1.66816 WP_000571108.1.66818 WP_000571108.1.6684 WP_000571108.1.66853 WP_000571108.1.6688 WP_000571108.1.66904 WP_000571108.1.66906 WP_000571108.1.66938 WP_000571108.1.66969 WP_000571108.1.66979 WP_000571108.1.66996 WP_000571108.1.67006 WP_000571108.1.67012 WP_000571108.1.67014 WP_000571108.1.67016 WP_000571108.1.67063 WP_000571108.1.67067 WP_000571108.1.67072 WP_000571108.1.67090 WP_000571108.1.67112 WP_000571108.1.67113 WP_000571108.1.67135 WP_000571108.1.67147 WP_000571108.1.67152 WP_000571108.1.67155 WP_000571108.1.67160 WP_000571108.1.67191 WP_000571108.1.67204 WP_000571108.1.67212 WP_000571108.1.6722 WP_000571108.1.67238 WP_000571108.1.67259 WP_000571108.1.6726 WP_000571108.1.67266 WP_000571108.1.67286 WP_000571108.1.67294 WP_000571108.1.67296 WP_000571108.1.67297 WP_000571108.1.67312 WP_000571108.1.67328 WP_000571108.1.67329 WP_000571108.1.67333 WP_000571108.1.67375 WP_000571108.1.67379 WP_000571108.1.6740 WP_000571108.1.67414 WP_000571108.1.67418 WP_000571108.1.67420 WP_000571108.1.67425 WP_000571108.1.67457 WP_000571108.1.67460 WP_000571108.1.67463 WP_000571108.1.67480 WP_000571108.1.67505 WP_000571108.1.67507 WP_000571108.1.67513 WP_000571108.1.67520 WP_000571108.1.67521 WP_000571108.1.67540 WP_000571108.1.67554 WP_000571108.1.67571 WP_000571108.1.67572 WP_000571108.1.67609 WP_000571108.1.67612 WP_000571108.1.67618 WP_000571108.1.67620 WP_000571108.1.67621 WP_000571108.1.67632 WP_000571108.1.67644 WP_000571108.1.67651 WP_000571108.1.67652 WP_000571108.1.67653 WP_000571108.1.67691 WP_000571108.1.67703 WP_000571108.1.67712 WP_000571108.1.67713 WP_000571108.1.67722 WP_000571108.1.67752 WP_000571108.1.67754 WP_000571108.1.67767 WP_000571108.1.67798 WP_000571108.1.67800 WP_000571108.1.67806 WP_000571108.1.67808 WP_000571108.1.67815 WP_000571108.1.67834 WP_000571108.1.6786 WP_000571108.1.67864 WP_000571108.1.67865 WP_000571108.1.67867 WP_000571108.1.67880 WP_000571108.1.67889 WP_000571108.1.67900 WP_000571108.1.67925 WP_000571108.1.67931 WP_000571108.1.67941 WP_000571108.1.67986 WP_000571108.1.67991 WP_000571108.1.68001 WP_000571108.1.68020 WP_000571108.1.68033 WP_000571108.1.68054 WP_000571108.1.68066 WP_000571108.1.68101 WP_000571108.1.68102 WP_000571108.1.6811 WP_000571108.1.68111 WP_000571108.1.68134 WP_000571108.1.68141 WP_000571108.1.68152 WP_000571108.1.68160 WP_000571108.1.68161 WP_000571108.1.68199 WP_000571108.1.68202 WP_000571108.1.68219 WP_000571108.1.68221 WP_000571108.1.68223 WP_000571108.1.68233 WP_000571108.1.6824 WP_000571108.1.68261 WP_000571108.1.68268 WP_000571108.1.68286 WP_000571108.1.68295 WP_000571108.1.68299 WP_000571108.1.6830 WP_000571108.1.68307 WP_000571108.1.68334 WP_000571108.1.6834 WP_000571108.1.68343 WP_000571108.1.68351 WP_000571108.1.68355 WP_000571108.1.68366 WP_000571108.1.68367 WP_000571108.1.6839 WP_000571108.1.68392 WP_000571108.1.68397 WP_000571108.1.68398 WP_000571108.1.68399 WP_000571108.1.68404 WP_000571108.1.68416 WP_000571108.1.68425 WP_000571108.1.68466 WP_000571108.1.68476 WP_000571108.1.68479 WP_000571108.1.68483 WP_000571108.1.68489 WP_000571108.1.68504 WP_000571108.1.68512 WP_000571108.1.68522 WP_000571108.1.68542 WP_000571108.1.68548 WP_000571108.1.68565 WP_000571108.1.68575 WP_000571108.1.686 WP_000571108.1.68650 WP_000571108.1.68657 WP_000571108.1.68681 WP_000571108.1.68683 WP_000571108.1.68699 WP_000571108.1.68703 WP_000571108.1.68716 WP_000571108.1.68728 WP_000571108.1.68737 WP_000571108.1.68741 WP_000571108.1.68743 WP_000571108.1.68747 WP_000571108.1.68773 WP_000571108.1.68775 WP_000571108.1.68813 WP_000571108.1.68831 WP_000571108.1.68854 WP_000571108.1.68878 WP_000571108.1.68883 WP_000571108.1.68917 WP_000571108.1.68931 WP_000571108.1.68943 WP_000571108.1.68944 WP_000571108.1.68987 WP_000571108.1.68988 WP_000571108.1.68998 WP_000571108.1.69012 WP_000571108.1.69016 WP_000571108.1.69045 WP_000571108.1.69071 WP_000571108.1.69078 WP_000571108.1.69087 WP_000571108.1.69089 WP_000571108.1.69105 WP_000571108.1.69110 WP_000571108.1.69111 WP_000571108.1.69120 WP_000571108.1.69125 WP_000571108.1.69147 WP_000571108.1.6915 WP_000571108.1.69162 WP_000571108.1.6917 WP_000571108.1.69179 WP_000571108.1.69191 WP_000571108.1.69198 WP_000571108.1.69213 WP_000571108.1.69219 WP_000571108.1.69222 WP_000571108.1.69237 WP_000571108.1.69266 WP_000571108.1.69280 WP_000571108.1.69314 WP_000571108.1.69349 WP_000571108.1.69366 WP_000571108.1.69378 WP_000571108.1.69394 WP_000571108.1.69395 WP_000571108.1.69409 WP_000571108.1.69412 WP_000571108.1.69415 WP_000571108.1.69434 WP_000571108.1.69437 WP_000571108.1.69446 WP_000571108.1.69475 WP_000571108.1.69476 WP_000571108.1.69477 WP_000571108.1.69480 WP_000571108.1.69483 WP_000571108.1.69484 WP_000571108.1.69489 WP_000571108.1.69490 WP_000571108.1.695 WP_000571108.1.69520 WP_000571108.1.69546 WP_000571108.1.69552 WP_000571108.1.69559 WP_000571108.1.69563 WP_000571108.1.69598 WP_000571108.1.69622 WP_000571108.1.69639 WP_000571108.1.69679 WP_000571108.1.6968 WP_000571108.1.69683 WP_000571108.1.69685 WP_000571108.1.69718 WP_000571108.1.69721 WP_000571108.1.69724 WP_000571108.1.69734 WP_000571108.1.6980 WP_000571108.1.69820 WP_000571108.1.69823 WP_000571108.1.69830 WP_000571108.1.69877 WP_000571108.1.69878 WP_000571108.1.69882 WP_000571108.1.699 WP_000571108.1.69902 WP_000571108.1.69921 WP_000571108.1.69934 WP_000571108.1.69980 WP_000571108.1.69987 WP_000571108.1.69995 WP_000571108.1.70024 WP_000571108.1.70048 WP_000571108.1.70059 WP_000571108.1.70089 WP_000571108.1.70094 WP_000571108.1.70105 WP_000571108.1.7012 WP_000571108.1.70133 WP_000571108.1.70161 WP_000571108.1.70220 WP_000571108.1.70225 WP_000571108.1.70228 WP_000571108.1.7024 WP_000571108.1.70253 WP_000571108.1.70266 WP_000571108.1.70273 WP_000571108.1.70294 WP_000571108.1.7030 WP_000571108.1.70311 WP_000571108.1.70313 WP_000571108.1.70334 WP_000571108.1.70338 WP_000571108.1.7034 WP_000571108.1.70344 WP_000571108.1.70349 WP_000571108.1.70361 WP_000571108.1.70389 WP_000571108.1.70413 WP_000571108.1.7043 WP_000571108.1.70438 WP_000571108.1.70441 WP_000571108.1.70448 WP_000571108.1.70451 WP_000571108.1.70457 WP_000571108.1.70459 WP_000571108.1.7046 WP_000571108.1.70462 WP_000571108.1.70487 WP_000571108.1.70495 WP_000571108.1.70527 WP_000571108.1.7053 WP_000571108.1.70541 WP_000571108.1.70546 WP_000571108.1.70554 WP_000571108.1.70558 WP_000571108.1.70564 WP_000571108.1.70572 WP_000571108.1.706 WP_000571108.1.7061 WP_000571108.1.70635 WP_000571108.1.7064 WP_000571108.1.70641 WP_000571108.1.70651 WP_000571108.1.70664 WP_000571108.1.7067 WP_000571108.1.70672 WP_000571108.1.707 WP_000571108.1.7071 WP_000571108.1.70721 WP_000571108.1.7073 WP_000571108.1.70763 WP_000571108.1.70790 WP_000571108.1.70791 WP_000571108.1.70808 WP_000571108.1.70818 WP_000571108.1.70823 WP_000571108.1.70829 WP_000571108.1.70835 WP_000571108.1.70843 WP_000571108.1.70850 WP_000571108.1.70855 WP_000571108.1.7089 WP_000571108.1.70909 WP_000571108.1.70917 WP_000571108.1.70924 WP_000571108.1.70926 WP_000571108.1.70930 WP_000571108.1.70943 WP_000571108.1.70994 WP_000571108.1.710 WP_000571108.1.71016 WP_000571108.1.71027 WP_000571108.1.71043 WP_000571108.1.7105 WP_000571108.1.71058 WP_000571108.1.71059 WP_000571108.1.71073 WP_000571108.1.7109 WP_000571108.1.711 WP_000571108.1.71130 WP_000571108.1.71179 WP_000571108.1.7119 WP_000571108.1.71196 WP_000571108.1.7120 WP_000571108.1.71208 WP_000571108.1.71231 WP_000571108.1.71236 WP_000571108.1.7125 WP_000571108.1.71256 WP_000571108.1.71257 WP_000571108.1.71266 WP_000571108.1.71267 WP_000571108.1.71280 WP_000571108.1.71295 WP_000571108.1.71298 WP_000571108.1.71301 WP_000571108.1.71313 WP_000571108.1.71316 WP_000571108.1.71325 WP_000571108.1.71332 WP_000571108.1.71345 WP_000571108.1.71351 WP_000571108.1.71359 WP_000571108.1.71404 WP_000571108.1.71410 WP_000571108.1.71428 WP_000571108.1.71431 WP_000571108.1.71438 WP_000571108.1.71463 WP_000571108.1.71467 WP_000571108.1.71475 WP_000571108.1.71483 WP_000571108.1.7150 WP_000571108.1.71519 WP_000571108.1.71521 WP_000571108.1.71529 WP_000571108.1.71541 WP_000571108.1.71543 WP_000571108.1.71547 WP_000571108.1.71572 WP_000571108.1.71575 WP_000571108.1.71596 WP_000571108.1.71602 WP_000571108.1.7161 WP_000571108.1.7164 WP_000571108.1.71644 WP_000571108.1.71662 WP_000571108.1.71676 WP_000571108.1.71707 WP_000571108.1.71715 WP_000571108.1.71735 WP_000571108.1.71737 WP_000571108.1.71739 WP_000571108.1.71741 WP_000571108.1.71771 WP_000571108.1.71772 WP_000571108.1.71788 WP_000571108.1.7179 WP_000571108.1.71800 WP_000571108.1.71828 WP_000571108.1.71836 WP_000571108.1.71859 WP_000571108.1.71861 WP_000571108.1.71863 WP_000571108.1.71877 WP_000571108.1.71888 WP_000571108.1.71892 WP_000571108.1.71899 WP_000571108.1.71910 WP_000571108.1.71925 WP_000571108.1.7193 WP_000571108.1.71949 WP_000571108.1.71978 WP_000571108.1.7198 WP_000571108.1.71981 WP_000571108.1.71989 WP_000571108.1.72002 WP_000571108.1.72018 WP_000571108.1.72026 WP_000571108.1.72031 WP_000571108.1.72035 WP_000571108.1.72067 WP_000571108.1.72085 WP_000571108.1.72089 WP_000571108.1.72099 WP_000571108.1.72102 WP_000571108.1.72112 WP_000571108.1.72148 WP_000571108.1.72169 WP_000571108.1.72176 WP_000571108.1.72204 WP_000571108.1.72205 WP_000571108.1.72224 WP_000571108.1.72257 WP_000571108.1.72271 WP_000571108.1.72285 WP_000571108.1.72306 WP_000571108.1.72315 WP_000571108.1.72330 WP_000571108.1.72340 WP_000571108.1.72347 WP_000571108.1.7236 WP_000571108.1.72363 WP_000571108.1.72366 WP_000571108.1.72371 WP_000571108.1.7242 WP_000571108.1.72424 WP_000571108.1.72433 WP_000571108.1.72446 WP_000571108.1.72453 WP_000571108.1.72465 WP_000571108.1.72489 WP_000571108.1.72496 WP_000571108.1.72497 WP_000571108.1.72529 WP_000571108.1.7254 WP_000571108.1.72547 WP_000571108.1.72564 WP_000571108.1.7258 WP_000571108.1.7260 WP_000571108.1.72626 WP_000571108.1.72649 WP_000571108.1.72654 WP_000571108.1.72666 WP_000571108.1.72708 WP_000571108.1.72719 WP_000571108.1.72750 WP_000571108.1.72753 WP_000571108.1.72760 WP_000571108.1.72762 WP_000571108.1.7278 WP_000571108.1.72787 WP_000571108.1.72832 WP_000571108.1.72834 WP_000571108.1.72835 WP_000571108.1.72874 WP_000571108.1.72881 WP_000571108.1.72903 WP_000571108.1.72904 WP_000571108.1.7292 WP_000571108.1.72930 WP_000571108.1.72935 WP_000571108.1.7294 WP_000571108.1.72945 WP_000571108.1.72961 WP_000571108.1.72965 WP_000571108.1.72991 WP_000571108.1.73002 WP_000571108.1.73004 WP_000571108.1.73017 WP_000571108.1.73019 WP_000571108.1.73021 WP_000571108.1.73022 WP_000571108.1.73037 WP_000571108.1.73046 WP_000571108.1.73074 WP_000571108.1.73087 WP_000571108.1.73121 WP_000571108.1.73122 WP_000571108.1.73132 WP_000571108.1.73140 WP_000571108.1.73190 WP_000571108.1.73191 WP_000571108.1.73195 WP_000571108.1.73201 WP_000571108.1.73211 WP_000571108.1.73240 WP_000571108.1.73241 WP_000571108.1.73246 WP_000571108.1.7326 WP_000571108.1.73264 WP_000571108.1.73265 WP_000571108.1.73286 WP_000571108.1.73312 WP_000571108.1.73386 WP_000571108.1.73401 WP_000571108.1.73420 WP_000571108.1.73450 WP_000571108.1.73456 WP_000571108.1.73464 WP_000571108.1.73467 WP_000571108.1.73489 WP_000571108.1.73501 WP_000571108.1.73513 WP_000571108.1.73526 WP_000571108.1.73536 WP_000571108.1.73539 WP_000571108.1.73547 WP_000571108.1.73571 WP_000571108.1.73591 WP_000571108.1.736 WP_000571108.1.7360 WP_000571108.1.73610 WP_000571108.1.73639 WP_000571108.1.73640 WP_000571108.1.7365 WP_000571108.1.73674 WP_000571108.1.73685 WP_000571108.1.73687 WP_000571108.1.73693 WP_000571108.1.73694 WP_000571108.1.73733 WP_000571108.1.73735 WP_000571108.1.73736 WP_000571108.1.73740 WP_000571108.1.73759 WP_000571108.1.73786 WP_000571108.1.73789 WP_000571108.1.7380 WP_000571108.1.73834 WP_000571108.1.73837 WP_000571108.1.73853 WP_000571108.1.73858 WP_000571108.1.73868 WP_000571108.1.73880 WP_000571108.1.73885 WP_000571108.1.73900 WP_000571108.1.73902 WP_000571108.1.73910 WP_000571108.1.73920 WP_000571108.1.73921 WP_000571108.1.73940 WP_000571108.1.73949 WP_000571108.1.73961 WP_000571108.1.73969 WP_000571108.1.73971 WP_000571108.1.73976 WP_000571108.1.73983 WP_000571108.1.74004 WP_000571108.1.74006 WP_000571108.1.7401 WP_000571108.1.74010 WP_000571108.1.74013 WP_000571108.1.74025 WP_000571108.1.74027 WP_000571108.1.7406 WP_000571108.1.74073 WP_000571108.1.74081 WP_000571108.1.74085 WP_000571108.1.74138 WP_000571108.1.74155 WP_000571108.1.74157 WP_000571108.1.74158 WP_000571108.1.74161 WP_000571108.1.74173 WP_000571108.1.7418 WP_000571108.1.74183 WP_000571108.1.74187 WP_000571108.1.74201 WP_000571108.1.74216 WP_000571108.1.74221 WP_000571108.1.74234 WP_000571108.1.74237 WP_000571108.1.74242 WP_000571108.1.74257 WP_000571108.1.7427 WP_000571108.1.7428 WP_000571108.1.74284 WP_000571108.1.74295 WP_000571108.1.74327 WP_000571108.1.74338 WP_000571108.1.7434 WP_000571108.1.74353 WP_000571108.1.74380 WP_000571108.1.74390 WP_000571108.1.74429 WP_000571108.1.74456 WP_000571108.1.74457 WP_000571108.1.74468 WP_000571108.1.74474 WP_000571108.1.74486 WP_000571108.1.74497 WP_000571108.1.74510 WP_000571108.1.74533 WP_000571108.1.74556 WP_000571108.1.7457 WP_000571108.1.74576 WP_000571108.1.74587 WP_000571108.1.74590 WP_000571108.1.74610 WP_000571108.1.74638 WP_000571108.1.74645 WP_000571108.1.74676 WP_000571108.1.74681 WP_000571108.1.74696 WP_000571108.1.74704 WP_000571108.1.74731 WP_000571108.1.74747 WP_000571108.1.74758 WP_000571108.1.74770 WP_000571108.1.74775 WP_000571108.1.74781 WP_000571108.1.74785 WP_000571108.1.74797 WP_000571108.1.74802 WP_000571108.1.74808 WP_000571108.1.7482 WP_000571108.1.74846 WP_000571108.1.74849 WP_000571108.1.74866 WP_000571108.1.74874 WP_000571108.1.74890 WP_000571108.1.74899 WP_000571108.1.74911 WP_000571108.1.74922 WP_000571108.1.74961 WP_000571108.1.74963 WP_000571108.1.74985 WP_000571108.1.74994 WP_000571108.1.74999 WP_000571108.1.7500 WP_000571108.1.75006 WP_000571108.1.75038 WP_000571108.1.75044 WP_000571108.1.75048 WP_000571108.1.75052 WP_000571108.1.75070 WP_000571108.1.75091 WP_000571108.1.75111 WP_000571108.1.75122 WP_000571108.1.75127 WP_000571108.1.75131 WP_000571108.1.75132 WP_000571108.1.75186 WP_000571108.1.75227 WP_000571108.1.75252 WP_000571108.1.75253 WP_000571108.1.75294 WP_000571108.1.75298 WP_000571108.1.75304 WP_000571108.1.75320 WP_000571108.1.75323 WP_000571108.1.75327 WP_000571108.1.75349 WP_000571108.1.75351 WP_000571108.1.75356 WP_000571108.1.75365 WP_000571108.1.75369 WP_000571108.1.75375 WP_000571108.1.75399 WP_000571108.1.75409 WP_000571108.1.75411 WP_000571108.1.7542 WP_000571108.1.75438 WP_000571108.1.75440 WP_000571108.1.75481 WP_000571108.1.75506 WP_000571108.1.75509 WP_000571108.1.75521 WP_000571108.1.75527 WP_000571108.1.75538 WP_000571108.1.75542 WP_000571108.1.75551 WP_000571108.1.75566 WP_000571108.1.75571 WP_000571108.1.75590 WP_000571108.1.7561 WP_000571108.1.75623 WP_000571108.1.75647 WP_000571108.1.75649 WP_000571108.1.75652 WP_000571108.1.75680 WP_000571108.1.75685 WP_000571108.1.75692 WP_000571108.1.75704 WP_000571108.1.75728 WP_000571108.1.75743 WP_000571108.1.75769 WP_000571108.1.75770 WP_000571108.1.75775 WP_000571108.1.758 WP_000571108.1.75800 WP_000571108.1.75805 WP_000571108.1.75809 WP_000571108.1.75824 WP_000571108.1.75830 WP_000571108.1.75840 WP_000571108.1.75851 WP_000571108.1.75856 WP_000571108.1.75879 WP_000571108.1.75881 WP_000571108.1.75885 WP_000571108.1.75910 WP_000571108.1.75929 WP_000571108.1.75944 WP_000571108.1.75952 WP_000571108.1.75956 WP_000571108.1.7596 WP_000571108.1.75969 WP_000571108.1.76010 WP_000571108.1.76013 WP_000571108.1.76015 WP_000571108.1.7602 WP_000571108.1.76047 WP_000571108.1.76049 WP_000571108.1.76050 WP_000571108.1.76053 WP_000571108.1.7607 WP_000571108.1.76071 WP_000571108.1.76073 WP_000571108.1.76095 WP_000571108.1.76104 WP_000571108.1.76111 WP_000571108.1.76112 WP_000571108.1.76114 WP_000571108.1.76121 WP_000571108.1.76123 WP_000571108.1.76136 WP_000571108.1.76143 WP_000571108.1.76153 WP_000571108.1.76179 WP_000571108.1.76185 WP_000571108.1.76230 WP_000571108.1.76234 WP_000571108.1.7624 WP_000571108.1.7625 WP_000571108.1.76258 WP_000571108.1.76261 WP_000571108.1.7627 WP_000571108.1.76282 WP_000571108.1.76294 WP_000571108.1.76295 WP_000571108.1.76313 WP_000571108.1.76323 WP_000571108.1.76332 WP_000571108.1.76333 WP_000571108.1.76337 WP_000571108.1.76351 WP_000571108.1.7638 WP_000571108.1.76411 WP_000571108.1.76419 WP_000571108.1.76420 WP_000571108.1.76421 WP_000571108.1.76424 WP_000571108.1.76426 WP_000571108.1.76431 WP_000571108.1.76463 WP_000571108.1.76482 WP_000571108.1.76497 WP_000571108.1.765 WP_000571108.1.7658 WP_000571108.1.76604 WP_000571108.1.76606 WP_000571108.1.76624 WP_000571108.1.76648 WP_000571108.1.76659 WP_000571108.1.76674 WP_000571108.1.76686 WP_000571108.1.76689 WP_000571108.1.76690 WP_000571108.1.76693 WP_000571108.1.76711 WP_000571108.1.76718 WP_000571108.1.7675 WP_000571108.1.76790 WP_000571108.1.76792 WP_000571108.1.76798 WP_000571108.1.768 WP_000571108.1.76803 WP_000571108.1.76816 WP_000571108.1.76829 WP_000571108.1.76839 WP_000571108.1.76845 WP_000571108.1.7686 WP_000571108.1.76867 WP_000571108.1.76869 WP_000571108.1.76872 WP_000571108.1.76876 WP_000571108.1.76878 WP_000571108.1.76895 WP_000571108.1.76897 WP_000571108.1.76920 WP_000571108.1.76921 WP_000571108.1.76937 WP_000571108.1.7694 WP_000571108.1.76944 WP_000571108.1.76952 WP_000571108.1.76998 WP_000571108.1.77013 WP_000571108.1.77027 WP_000571108.1.77031 WP_000571108.1.77041 WP_000571108.1.77043 WP_000571108.1.77050 WP_000571108.1.77060 WP_000571108.1.77062 WP_000571108.1.77069 WP_000571108.1.77072 WP_000571108.1.77112 WP_000571108.1.77137 WP_000571108.1.77144 WP_000571108.1.77145 WP_000571108.1.77158 WP_000571108.1.77176 WP_000571108.1.77183 WP_000571108.1.77187 WP_000571108.1.77190 WP_000571108.1.77203 WP_000571108.1.77229 WP_000571108.1.77259 WP_000571108.1.77297 WP_000571108.1.77298 WP_000571108.1.77305 WP_000571108.1.77315 WP_000571108.1.77331 WP_000571108.1.77346 WP_000571108.1.77354 WP_000571108.1.77359 WP_000571108.1.77388 WP_000571108.1.77416 WP_000571108.1.77426 WP_000571108.1.77446 WP_000571108.1.7745 WP_000571108.1.7746 WP_000571108.1.77485 WP_000571108.1.77489 WP_000571108.1.77497 WP_000571108.1.77498 WP_000571108.1.77520 WP_000571108.1.77527 WP_000571108.1.77532 WP_000571108.1.77533 WP_000571108.1.77536 WP_000571108.1.77572 WP_000571108.1.77583 WP_000571108.1.77603 WP_000571108.1.77606 WP_000571108.1.77650 WP_000571108.1.77674 WP_000571108.1.77735 WP_000571108.1.77738 WP_000571108.1.7774 WP_000571108.1.77743 WP_000571108.1.77745 WP_000571108.1.77791 WP_000571108.1.77805 WP_000571108.1.77814 WP_000571108.1.77818 WP_000571108.1.77822 WP_000571108.1.77827 WP_000571108.1.77832 WP_000571108.1.77848 WP_000571108.1.7785 WP_000571108.1.77858 WP_000571108.1.7786 WP_000571108.1.77860 WP_000571108.1.7787 WP_000571108.1.77882 WP_000571108.1.77883 WP_000571108.1.77893 WP_000571108.1.77896 WP_000571108.1.77908 WP_000571108.1.77915 WP_000571108.1.77922 WP_000571108.1.77930 WP_000571108.1.77952 WP_000571108.1.77957 WP_000571108.1.77986 WP_000571108.1.78002 WP_000571108.1.78038 WP_000571108.1.78050 WP_000571108.1.78054 WP_000571108.1.78067 WP_000571108.1.78082 WP_000571108.1.78091 WP_000571108.1.78093 WP_000571108.1.78095 WP_000571108.1.78116 WP_000571108.1.78126 WP_000571108.1.78164 WP_000571108.1.78173 WP_000571108.1.78179 WP_000571108.1.78185 WP_000571108.1.78189 WP_000571108.1.78194 WP_000571108.1.78207 WP_000571108.1.78210 WP_000571108.1.78252 WP_000571108.1.78254 WP_000571108.1.78257 WP_000571108.1.7827 WP_000571108.1.78304 WP_000571108.1.78311 WP_000571108.1.78324 WP_000571108.1.7833 WP_000571108.1.78330 WP_000571108.1.78332 WP_000571108.1.78335 WP_000571108.1.78365 WP_000571108.1.78371 WP_000571108.1.78392 WP_000571108.1.78404 WP_000571108.1.78434 WP_000571108.1.78436 WP_000571108.1.78458 WP_000571108.1.78470 WP_000571108.1.78478 WP_000571108.1.78489 WP_000571108.1.78494 WP_000571108.1.7850 WP_000571108.1.78513 WP_000571108.1.7853 WP_000571108.1.78550 WP_000571108.1.78558 WP_000571108.1.7857 WP_000571108.1.78573 WP_000571108.1.78582 WP_000571108.1.78585 WP_000571108.1.78592 WP_000571108.1.78596 WP_000571108.1.78604 WP_000571108.1.78625 WP_000571108.1.78633 WP_000571108.1.78653 WP_000571108.1.78662 WP_000571108.1.78667 WP_000571108.1.7868 WP_000571108.1.78685 WP_000571108.1.78728 WP_000571108.1.78731 WP_000571108.1.78736 WP_000571108.1.78758 WP_000571108.1.78763 WP_000571108.1.78785 WP_000571108.1.78803 WP_000571108.1.78816 WP_000571108.1.78819 WP_000571108.1.78841 WP_000571108.1.78872 WP_000571108.1.7888 WP_000571108.1.78897 WP_000571108.1.78920 WP_000571108.1.78934 WP_000571108.1.78937 WP_000571108.1.78946 WP_000571108.1.78978 WP_000571108.1.78983 WP_000571108.1.78985 WP_000571108.1.78991 WP_000571108.1.78995 WP_000571108.1.7900 WP_000571108.1.79006 WP_000571108.1.79037 WP_000571108.1.79038 WP_000571108.1.7905 WP_000571108.1.79051 WP_000571108.1.79059 WP_000571108.1.79085 WP_000571108.1.79110 WP_000571108.1.79114 WP_000571108.1.79131 WP_000571108.1.79132 WP_000571108.1.7914 WP_000571108.1.79143 WP_000571108.1.79156 WP_000571108.1.79170 WP_000571108.1.79178 WP_000571108.1.79192 WP_000571108.1.79197 WP_000571108.1.79208 WP_000571108.1.79223 WP_000571108.1.79227 WP_000571108.1.79244 WP_000571108.1.79275 WP_000571108.1.79285 WP_000571108.1.7930 WP_000571108.1.7931 WP_000571108.1.79310 WP_000571108.1.79314 WP_000571108.1.79320 WP_000571108.1.79322 WP_000571108.1.79332 WP_000571108.1.79334 WP_000571108.1.7934 WP_000571108.1.79367 WP_000571108.1.79374 WP_000571108.1.79378 WP_000571108.1.79379 WP_000571108.1.79400 WP_000571108.1.79407 WP_000571108.1.79408 WP_000571108.1.79436 WP_000571108.1.79452 WP_000571108.1.79461 WP_000571108.1.79473 WP_000571108.1.79476 WP_000571108.1.79487 WP_000571108.1.79539 WP_000571108.1.79543 WP_000571108.1.79552 WP_000571108.1.79554 WP_000571108.1.79556 WP_000571108.1.79566 WP_000571108.1.79581 WP_000571108.1.79626 WP_000571108.1.79627 WP_000571108.1.79646 WP_000571108.1.79662 WP_000571108.1.79664 WP_000571108.1.79672 WP_000571108.1.79676 WP_000571108.1.79677 WP_000571108.1.79706 WP_000571108.1.79731 WP_000571108.1.79737 WP_000571108.1.79763 WP_000571108.1.7981 WP_000571108.1.79810 WP_000571108.1.79815 WP_000571108.1.79822 WP_000571108.1.79831 WP_000571108.1.79834 WP_000571108.1.79837 WP_000571108.1.79854 WP_000571108.1.7989 WP_000571108.1.79896 WP_000571108.1.79904 WP_000571108.1.79911 WP_000571108.1.79919 WP_000571108.1.7992 WP_000571108.1.79941 WP_000571108.1.79949 WP_000571108.1.79961 WP_000571108.1.79971 WP_000571108.1.79991 WP_000571108.1.80000 WP_000571108.1.80009 WP_000571108.1.80013 WP_000571108.1.80029 WP_000571108.1.80032 WP_000571108.1.80034 WP_000571108.1.80042 WP_000571108.1.80079 WP_000571108.1.80086 WP_000571108.1.80109 WP_000571108.1.80119 WP_000571108.1.80120 WP_000571108.1.80122 WP_000571108.1.80124 WP_000571108.1.80127 WP_000571108.1.80146 WP_000571108.1.80147 WP_000571108.1.80152 WP_000571108.1.80159 WP_000571108.1.80178 WP_000571108.1.80181 WP_000571108.1.80184 WP_000571108.1.80193 WP_000571108.1.80203 WP_000571108.1.80210 WP_000571108.1.80244 WP_000571108.1.80274 WP_000571108.1.80286 WP_000571108.1.80287 WP_000571108.1.80290 WP_000571108.1.8030 WP_000571108.1.80303 WP_000571108.1.80308 WP_000571108.1.8031 WP_000571108.1.80316 WP_000571108.1.80317 WP_000571108.1.80318 WP_000571108.1.80345 WP_000571108.1.8035 WP_000571108.1.80358 WP_000571108.1.80361 WP_000571108.1.80378 WP_000571108.1.80389 WP_000571108.1.80393 WP_000571108.1.8040 WP_000571108.1.80407 WP_000571108.1.8043 WP_000571108.1.80430 WP_000571108.1.80434 WP_000571108.1.8045 WP_000571108.1.80472 WP_000571108.1.80482 WP_000571108.1.80521 WP_000571108.1.80530 WP_000571108.1.80582 WP_000571108.1.80647 WP_000571108.1.8065 WP_000571108.1.80653 WP_000571108.1.8066 WP_000571108.1.80680 WP_000571108.1.80687 WP_000571108.1.80734 WP_000571108.1.80745 WP_000571108.1.80761 WP_000571108.1.80762 WP_000571108.1.80763 WP_000571108.1.8077 WP_000571108.1.80781 WP_000571108.1.80786 WP_000571108.1.80793 WP_000571108.1.80801 WP_000571108.1.80828 WP_000571108.1.80833 WP_000571108.1.8084 WP_000571108.1.80845 WP_000571108.1.8085 WP_000571108.1.80855 WP_000571108.1.80872 WP_000571108.1.80899 WP_000571108.1.80962 WP_000571108.1.80972 WP_000571108.1.80979 WP_000571108.1.80980 WP_000571108.1.81049 WP_000571108.1.81052 WP_000571108.1.81055 WP_000571108.1.81064 WP_000571108.1.81065 WP_000571108.1.81085 WP_000571108.1.81092 WP_000571108.1.81095 WP_000571108.1.81114 WP_000571108.1.81132 WP_000571108.1.81151 WP_000571108.1.81157 WP_000571108.1.81171 WP_000571108.1.81172 WP_000571108.1.81176 WP_000571108.1.81184 WP_000571108.1.81214 WP_000571108.1.81224 WP_000571108.1.81228 WP_000571108.1.81232 WP_000571108.1.81234 WP_000571108.1.81243 WP_000571108.1.8125 WP_000571108.1.81252 WP_000571108.1.81288 WP_000571108.1.81290 WP_000571108.1.8135 WP_000571108.1.81384 WP_000571108.1.81385 WP_000571108.1.81387 WP_000571108.1.81389 WP_000571108.1.8142 WP_000571108.1.81436 WP_000571108.1.8144 WP_000571108.1.81464 WP_000571108.1.81467 WP_000571108.1.81508 WP_000571108.1.81522 WP_000571108.1.81532 WP_000571108.1.81549 WP_000571108.1.81572 WP_000571108.1.81574 WP_000571108.1.81599 WP_000571108.1.8160 WP_000571108.1.81604 WP_000571108.1.81610 WP_000571108.1.81619 WP_000571108.1.81631 WP_000571108.1.81637 WP_000571108.1.81645 WP_000571108.1.81651 WP_000571108.1.81718 WP_000571108.1.81734 WP_000571108.1.81738 WP_000571108.1.81740 WP_000571108.1.81758 WP_000571108.1.8176 WP_000571108.1.81789 WP_000571108.1.8180 WP_000571108.1.81800 WP_000571108.1.81812 WP_000571108.1.81829 WP_000571108.1.81837 WP_000571108.1.81838 WP_000571108.1.81847 WP_000571108.1.8185 WP_000571108.1.81861 WP_000571108.1.81870 WP_000571108.1.8188 WP_000571108.1.81897 WP_000571108.1.81903 WP_000571108.1.81904 WP_000571108.1.81905 WP_000571108.1.81906 WP_000571108.1.81919 WP_000571108.1.81940 WP_000571108.1.81944 WP_000571108.1.81969 WP_000571108.1.81982 WP_000571108.1.81990 WP_000571108.1.81996 WP_000571108.1.81999 WP_000571108.1.82009 WP_000571108.1.82015 WP_000571108.1.82017 WP_000571108.1.82026 WP_000571108.1.82053 WP_000571108.1.82058 WP_000571108.1.8206 WP_000571108.1.82091 WP_000571108.1.82100 WP_000571108.1.82103 WP_000571108.1.8212 WP_000571108.1.82121 WP_000571108.1.82161 WP_000571108.1.82167 WP_000571108.1.82174 WP_000571108.1.82184 WP_000571108.1.82219 WP_000571108.1.82234 WP_000571108.1.82247 WP_000571108.1.82253 WP_000571108.1.82259 WP_000571108.1.82278 WP_000571108.1.82281 WP_000571108.1.82301 WP_000571108.1.82315 WP_000571108.1.82321 WP_000571108.1.82340 WP_000571108.1.82349 WP_000571108.1.82354 WP_000571108.1.82358 WP_000571108.1.82368 WP_000571108.1.82406 WP_000571108.1.8244 WP_000571108.1.82441 WP_000571108.1.82447 WP_000571108.1.82455 WP_000571108.1.82458 WP_000571108.1.8246 WP_000571108.1.82467 WP_000571108.1.82468 WP_000571108.1.82472 WP_000571108.1.82525 WP_000571108.1.82535 WP_000571108.1.82548 WP_000571108.1.82558 WP_000571108.1.8261 WP_000571108.1.82612 WP_000571108.1.8265 WP_000571108.1.8266 WP_000571108.1.82664 WP_000571108.1.82665 WP_000571108.1.82678 WP_000571108.1.82709 WP_000571108.1.82724 WP_000571108.1.82760 WP_000571108.1.82762 WP_000571108.1.82768 WP_000571108.1.82775 WP_000571108.1.82796 WP_000571108.1.8280 WP_000571108.1.82802 WP_000571108.1.82824 WP_000571108.1.82829 WP_000571108.1.82835 WP_000571108.1.82855 WP_000571108.1.82862 WP_000571108.1.8288 WP_000571108.1.8289 WP_000571108.1.82916 WP_000571108.1.82930 WP_000571108.1.82931 WP_000571108.1.82941 WP_000571108.1.82976 WP_000571108.1.82980 WP_000571108.1.82984 WP_000571108.1.82997 WP_000571108.1.82999 WP_000571108.1.83011 WP_000571108.1.83013 WP_000571108.1.8302 WP_000571108.1.83021 WP_000571108.1.83046 WP_000571108.1.83050 WP_000571108.1.83053 WP_000571108.1.83054 WP_000571108.1.83078 WP_000571108.1.83086 WP_000571108.1.83088 WP_000571108.1.8310 WP_000571108.1.83103 WP_000571108.1.83152 WP_000571108.1.83153 WP_000571108.1.8318 WP_000571108.1.83185 WP_000571108.1.8319 WP_000571108.1.83193 WP_000571108.1.83203 WP_000571108.1.83234 WP_000571108.1.83243 WP_000571108.1.83249 WP_000571108.1.83250 WP_000571108.1.8328 WP_000571108.1.83291 WP_000571108.1.83314 WP_000571108.1.83316 WP_000571108.1.83352 WP_000571108.1.83359 WP_000571108.1.83372 WP_000571108.1.83405 WP_000571108.1.83416 WP_000571108.1.83417 WP_000571108.1.83418 WP_000571108.1.8346 WP_000571108.1.83467 WP_000571108.1.83468 WP_000571108.1.83472 WP_000571108.1.83475 WP_000571108.1.83476 WP_000571108.1.83479 WP_000571108.1.83484 WP_000571108.1.83508 WP_000571108.1.83517 WP_000571108.1.83520 WP_000571108.1.83541 WP_000571108.1.83553 WP_000571108.1.83592 WP_000571108.1.83593 WP_000571108.1.83597 WP_000571108.1.83626 WP_000571108.1.83645 WP_000571108.1.83646 WP_000571108.1.83653 WP_000571108.1.8366 WP_000571108.1.83674 WP_000571108.1.83676 WP_000571108.1.83714 WP_000571108.1.83720 WP_000571108.1.83728 WP_000571108.1.83750 WP_000571108.1.83756 WP_000571108.1.83758 WP_000571108.1.83763 WP_000571108.1.83770 WP_000571108.1.83775 WP_000571108.1.83778 WP_000571108.1.83788 WP_000571108.1.83792 WP_000571108.1.83797 WP_000571108.1.83816 WP_000571108.1.83825 WP_000571108.1.8383 WP_000571108.1.83837 WP_000571108.1.83844 WP_000571108.1.8385 WP_000571108.1.83852 WP_000571108.1.83864 WP_000571108.1.83865 WP_000571108.1.83881 WP_000571108.1.83886 WP_000571108.1.83902 WP_000571108.1.83912 WP_000571108.1.83917 WP_000571108.1.83919 WP_000571108.1.83925 WP_000571108.1.83928 WP_000571108.1.83935 WP_000571108.1.83955 WP_000571108.1.83980 WP_000571108.1.83984 WP_000571108.1.83989 WP_000571108.1.84025 WP_000571108.1.84041 WP_000571108.1.84049 WP_000571108.1.84054 WP_000571108.1.84064 WP_000571108.1.84067 WP_000571108.1.84068 WP_000571108.1.84118 WP_000571108.1.84129 WP_000571108.1.84144 WP_000571108.1.84161 WP_000571108.1.84163 WP_000571108.1.84188 WP_000571108.1.84194 WP_000571108.1.84275 WP_000571108.1.84284 WP_000571108.1.84293 WP_000571108.1.8432 WP_000571108.1.84322 WP_000571108.1.84342 WP_000571108.1.84415 WP_000571108.1.84416 WP_000571108.1.84418 WP_000571108.1.84442 WP_000571108.1.84445 WP_000571108.1.84451 WP_000571108.1.84508 WP_000571108.1.84509 WP_000571108.1.84555 WP_000571108.1.84563 WP_000571108.1.84570 WP_000571108.1.84578 WP_000571108.1.84590 WP_000571108.1.84596 WP_000571108.1.84602 WP_000571108.1.84608 WP_000571108.1.84612 WP_000571108.1.8462 WP_000571108.1.84625 WP_000571108.1.84630 WP_000571108.1.84638 WP_000571108.1.84648 WP_000571108.1.84651 WP_000571108.1.84652 WP_000571108.1.84662 WP_000571108.1.84673 WP_000571108.1.84679 WP_000571108.1.8468 WP_000571108.1.84682 WP_000571108.1.84696 WP_000571108.1.84700 WP_000571108.1.84714 WP_000571108.1.84736 WP_000571108.1.8475 WP_000571108.1.84752 WP_000571108.1.84757 WP_000571108.1.84761 WP_000571108.1.84770 WP_000571108.1.84815 WP_000571108.1.84826 WP_000571108.1.84847 WP_000571108.1.84854 WP_000571108.1.84874 WP_000571108.1.84889 WP_000571108.1.84903 WP_000571108.1.84907 WP_000571108.1.84922 WP_000571108.1.84924 WP_000571108.1.8493 WP_000571108.1.84943 WP_000571108.1.84951 WP_000571108.1.8496 WP_000571108.1.84975 WP_000571108.1.84978 WP_000571108.1.85017 WP_000571108.1.85022 WP_000571108.1.85026 WP_000571108.1.85047 WP_000571108.1.85056 WP_000571108.1.85070 WP_000571108.1.85081 WP_000571108.1.85083 WP_000571108.1.85099 WP_000571108.1.851 WP_000571108.1.85113 WP_000571108.1.85118 WP_000571108.1.85132 WP_000571108.1.85133 WP_000571108.1.85135 WP_000571108.1.85144 WP_000571108.1.85151 WP_000571108.1.85173 WP_000571108.1.85198 WP_000571108.1.85213 WP_000571108.1.85224 WP_000571108.1.85226 WP_000571108.1.85229 WP_000571108.1.85235 WP_000571108.1.85238 WP_000571108.1.85265 WP_000571108.1.85289 WP_000571108.1.85294 WP_000571108.1.85297 WP_000571108.1.85302 WP_000571108.1.85331 WP_000571108.1.85351 WP_000571108.1.85354 WP_000571108.1.85374 WP_000571108.1.85375 WP_000571108.1.85376 WP_000571108.1.85383 WP_000571108.1.85391 WP_000571108.1.85395 WP_000571108.1.85401 WP_000571108.1.85404 WP_000571108.1.85425 WP_000571108.1.85441 WP_000571108.1.85445 WP_000571108.1.85455 WP_000571108.1.85462 WP_000571108.1.85471 WP_000571108.1.85474 WP_000571108.1.85485 WP_000571108.1.85492 WP_000571108.1.85506 WP_000571108.1.85515 WP_000571108.1.85519 WP_000571108.1.85542 WP_000571108.1.85547 WP_000571108.1.85549 WP_000571108.1.85562 WP_000571108.1.85585 WP_000571108.1.85586 WP_000571108.1.85607 WP_000571108.1.85611 WP_000571108.1.85634 WP_000571108.1.85649 WP_000571108.1.85678 WP_000571108.1.85705 WP_000571108.1.85730 WP_000571108.1.85732 WP_000571108.1.85758 WP_000571108.1.8576 WP_000571108.1.85795 WP_000571108.1.85796 WP_000571108.1.85809 WP_000571108.1.85816 WP_000571108.1.85825 WP_000571108.1.85834 WP_000571108.1.85844 WP_000571108.1.85858 WP_000571108.1.85873 WP_000571108.1.85906 WP_000571108.1.85924 WP_000571108.1.85927 WP_000571108.1.85950 WP_000571108.1.85971 WP_000571108.1.85980 WP_000571108.1.85993 WP_000571108.1.86018 WP_000571108.1.86036 WP_000571108.1.86042 WP_000571108.1.86072 WP_000571108.1.86086 WP_000571108.1.86101 WP_000571108.1.86106 WP_000571108.1.86123 WP_000571108.1.86136 WP_000571108.1.86144 WP_000571108.1.86153 WP_000571108.1.86154 WP_000571108.1.86158 WP_000571108.1.8617 WP_000571108.1.86178 WP_000571108.1.86188 WP_000571108.1.86197 WP_000571108.1.862 WP_000571108.1.86207 WP_000571108.1.86209 WP_000571108.1.86241 WP_000571108.1.86256 WP_000571108.1.8627 WP_000571108.1.86270 WP_000571108.1.86281 WP_000571108.1.86304 WP_000571108.1.86315 WP_000571108.1.86331 WP_000571108.1.86344 WP_000571108.1.8636 WP_000571108.1.86363 WP_000571108.1.86367 WP_000571108.1.86378 WP_000571108.1.8641 WP_000571108.1.8643 WP_000571108.1.86439 WP_000571108.1.86455 WP_000571108.1.86482 WP_000571108.1.86505 WP_000571108.1.86523 WP_000571108.1.86526 WP_000571108.1.86531 WP_000571108.1.86542 WP_000571108.1.86628 WP_000571108.1.86629 WP_000571108.1.8663 WP_000571108.1.86664 WP_000571108.1.86704 WP_000571108.1.86706 WP_000571108.1.86736 WP_000571108.1.86745 WP_000571108.1.86754 WP_000571108.1.86779 WP_000571108.1.86792 WP_000571108.1.86793 WP_000571108.1.86795 WP_000571108.1.8681 WP_000571108.1.86838 WP_000571108.1.8690 WP_000571108.1.86911 WP_000571108.1.86916 WP_000571108.1.86940 WP_000571108.1.86942 WP_000571108.1.86955 WP_000571108.1.86961 WP_000571108.1.86968 WP_000571108.1.86977 WP_000571108.1.8699 WP_000571108.1.86999 WP_000571108.1.87021 WP_000571108.1.87022 WP_000571108.1.87042 WP_000571108.1.87057 WP_000571108.1.87072 WP_000571108.1.87088 WP_000571108.1.87090 WP_000571108.1.87096 WP_000571108.1.87097 WP_000571108.1.87100 WP_000571108.1.87110 WP_000571108.1.87119 WP_000571108.1.87122 WP_000571108.1.87133 WP_000571108.1.87137 WP_000571108.1.87141 WP_000571108.1.87168 WP_000571108.1.87175 WP_000571108.1.87190 WP_000571108.1.87194 WP_000571108.1.8720 WP_000571108.1.87204 WP_000571108.1.87221 WP_000571108.1.87236 WP_000571108.1.87250 WP_000571108.1.87260 WP_000571108.1.87261 WP_000571108.1.87263 WP_000571108.1.87264 WP_000571108.1.87285 WP_000571108.1.87290 WP_000571108.1.87296 WP_000571108.1.8731 WP_000571108.1.87363 WP_000571108.1.87372 WP_000571108.1.87378 WP_000571108.1.87388 WP_000571108.1.87391 WP_000571108.1.87396 WP_000571108.1.87397 WP_000571108.1.87425 WP_000571108.1.87434 WP_000571108.1.87457 WP_000571108.1.87461 WP_000571108.1.87466 WP_000571108.1.87475 WP_000571108.1.87486 WP_000571108.1.87497 WP_000571108.1.87498 WP_000571108.1.875 WP_000571108.1.87502 WP_000571108.1.87508 WP_000571108.1.87511 WP_000571108.1.87515 WP_000571108.1.8753 WP_000571108.1.87534 WP_000571108.1.87541 WP_000571108.1.87543 WP_000571108.1.8757 WP_000571108.1.87579 WP_000571108.1.87593 WP_000571108.1.87595 WP_000571108.1.87623 WP_000571108.1.87636 WP_000571108.1.8764 WP_000571108.1.87682 WP_000571108.1.8770 WP_000571108.1.87703 WP_000571108.1.87710 WP_000571108.1.87718 WP_000571108.1.87734 WP_000571108.1.87735 WP_000571108.1.87740 WP_000571108.1.87745 WP_000571108.1.87748 WP_000571108.1.87764 WP_000571108.1.87782 WP_000571108.1.8779 WP_000571108.1.87802 WP_000571108.1.87808 WP_000571108.1.87828 WP_000571108.1.87841 WP_000571108.1.87843 WP_000571108.1.87854 WP_000571108.1.87865 WP_000571108.1.87879 WP_000571108.1.87912 WP_000571108.1.87937 WP_000571108.1.87943 WP_000571108.1.87948 WP_000571108.1.87967 WP_000571108.1.87972 WP_000571108.1.87985 WP_000571108.1.87995 WP_000571108.1.88013 WP_000571108.1.88032 WP_000571108.1.88061 WP_000571108.1.88101 WP_000571108.1.88114 WP_000571108.1.88150 WP_000571108.1.88166 WP_000571108.1.88169 WP_000571108.1.8820 WP_000571108.1.88212 WP_000571108.1.88240 WP_000571108.1.88270 WP_000571108.1.88279 WP_000571108.1.88309 WP_000571108.1.88317 WP_000571108.1.88319 WP_000571108.1.88328 WP_000571108.1.88339 WP_000571108.1.88348 WP_000571108.1.88351 WP_000571108.1.88367 WP_000571108.1.88371 WP_000571108.1.88375 WP_000571108.1.88380 WP_000571108.1.88395 WP_000571108.1.88418 WP_000571108.1.88430 WP_000571108.1.88440 WP_000571108.1.88445 WP_000571108.1.88449 WP_000571108.1.88455 WP_000571108.1.8847 WP_000571108.1.88471 WP_000571108.1.88478 WP_000571108.1.88480 WP_000571108.1.88490 WP_000571108.1.88498 WP_000571108.1.88504 WP_000571108.1.88518 WP_000571108.1.88536 WP_000571108.1.88558 WP_000571108.1.88560 WP_000571108.1.88563 WP_000571108.1.8857 WP_000571108.1.88572 WP_000571108.1.88580 WP_000571108.1.88583 WP_000571108.1.88585 WP_000571108.1.8859 WP_000571108.1.88599 WP_000571108.1.88600 WP_000571108.1.88614 WP_000571108.1.88623 WP_000571108.1.88636 WP_000571108.1.88638 WP_000571108.1.88642 WP_000571108.1.88671 WP_000571108.1.88694 WP_000571108.1.88696 WP_000571108.1.8872 WP_000571108.1.88738 WP_000571108.1.88739 WP_000571108.1.8877 WP_000571108.1.88771 WP_000571108.1.88781 WP_000571108.1.88805 WP_000571108.1.88827 WP_000571108.1.88843 WP_000571108.1.88856 WP_000571108.1.88859 WP_000571108.1.88861 WP_000571108.1.88871 WP_000571108.1.88874 WP_000571108.1.88878 WP_000571108.1.8888 WP_000571108.1.88881 WP_000571108.1.88912 WP_000571108.1.88922 WP_000571108.1.88934 WP_000571108.1.88954 WP_000571108.1.88959 WP_000571108.1.88960 WP_000571108.1.88962 WP_000571108.1.8899 WP_000571108.1.8900 WP_000571108.1.89012 WP_000571108.1.89024 WP_000571108.1.89027 WP_000571108.1.89036 WP_000571108.1.8904 WP_000571108.1.89086 WP_000571108.1.89103 WP_000571108.1.89108 WP_000571108.1.89125 WP_000571108.1.8913 WP_000571108.1.89133 WP_000571108.1.89139 WP_000571108.1.89164 WP_000571108.1.89173 WP_000571108.1.8918 WP_000571108.1.89181 WP_000571108.1.89184 WP_000571108.1.89194 WP_000571108.1.89195 WP_000571108.1.89204 WP_000571108.1.89216 WP_000571108.1.89229 WP_000571108.1.89237 WP_000571108.1.8924 WP_000571108.1.89258 WP_000571108.1.89262 WP_000571108.1.89284 WP_000571108.1.89290 WP_000571108.1.89347 WP_000571108.1.89348 WP_000571108.1.89350 WP_000571108.1.89372 WP_000571108.1.89390 WP_000571108.1.89404 WP_000571108.1.89414 WP_000571108.1.89433 WP_000571108.1.89439 WP_000571108.1.89476 WP_000571108.1.8950 WP_000571108.1.89516 WP_000571108.1.8953 WP_000571108.1.89537 WP_000571108.1.89544 WP_000571108.1.89545 WP_000571108.1.89556 WP_000571108.1.89557 WP_000571108.1.89559 WP_000571108.1.89628 WP_000571108.1.89651 WP_000571108.1.89655 WP_000571108.1.89672 WP_000571108.1.89678 WP_000571108.1.89686 WP_000571108.1.897 WP_000571108.1.89715 WP_000571108.1.89726 WP_000571108.1.89730 WP_000571108.1.89738 WP_000571108.1.89754 WP_000571108.1.89779 WP_000571108.1.89794 WP_000571108.1.89799 WP_000571108.1.898 WP_000571108.1.89857 WP_000571108.1.89860 WP_000571108.1.89863 WP_000571108.1.89874 WP_000571108.1.89883 WP_000571108.1.8990 WP_000571108.1.89908 WP_000571108.1.89924 WP_000571108.1.89933 WP_000571108.1.89935 WP_000571108.1.89949 WP_000571108.1.89950 WP_000571108.1.89960 WP_000571108.1.90005 WP_000571108.1.90018 WP_000571108.1.90038 WP_000571108.1.90046 WP_000571108.1.90055 WP_000571108.1.90069 WP_000571108.1.90091 WP_000571108.1.90095 WP_000571108.1.90131 WP_000571108.1.90145 WP_000571108.1.90148 WP_000571108.1.90161 WP_000571108.1.90173 WP_000571108.1.90174 WP_000571108.1.90180 WP_000571108.1.90215 WP_000571108.1.90217 WP_000571108.1.9022 WP_000571108.1.90239 WP_000571108.1.90243 WP_000571108.1.90244 WP_000571108.1.90246 WP_000571108.1.90250 WP_000571108.1.90253 WP_000571108.1.90269 WP_000571108.1.90276 WP_000571108.1.9030 WP_000571108.1.90307 WP_000571108.1.90331 WP_000571108.1.90345 WP_000571108.1.90367 WP_000571108.1.90370 WP_000571108.1.90386 WP_000571108.1.90447 WP_000571108.1.90454 WP_000571108.1.90473 WP_000571108.1.90475 WP_000571108.1.90488 WP_000571108.1.90506 WP_000571108.1.90514 WP_000571108.1.90517 WP_000571108.1.90533 WP_000571108.1.90544 WP_000571108.1.90548 WP_000571108.1.90554 WP_000571108.1.90556 WP_000571108.1.90562 WP_000571108.1.90604 WP_000571108.1.90647 WP_000571108.1.90660 WP_000571108.1.90661 WP_000571108.1.90683 WP_000571108.1.90698 WP_000571108.1.90717 WP_000571108.1.90726 WP_000571108.1.90728 WP_000571108.1.90738 WP_000571108.1.9074 WP_000571108.1.90740 WP_000571108.1.90745 WP_000571108.1.90757 WP_000571108.1.9076 WP_000571108.1.90777 WP_000571108.1.90801 WP_000571108.1.90804 WP_000571108.1.90818 WP_000571108.1.90820 WP_000571108.1.90861 WP_000571108.1.90875 WP_000571108.1.90887 WP_000571108.1.90896 WP_000571108.1.90903 WP_000571108.1.90928 WP_000571108.1.90994 WP_000571108.1.9100 WP_000571108.1.91005 WP_000571108.1.91011 WP_000571108.1.91019 WP_000571108.1.91054 WP_000571108.1.91087 WP_000571108.1.91089 WP_000571108.1.91124 WP_000571108.1.91126 WP_000571108.1.9114 WP_000571108.1.91150 WP_000571108.1.91158 WP_000571108.1.91177 WP_000571108.1.91184 WP_000571108.1.912 WP_000571108.1.9122 WP_000571108.1.91233 WP_000571108.1.91246 WP_000571108.1.91252 WP_000571108.1.91258 WP_000571108.1.9127 WP_000571108.1.91279 WP_000571108.1.91280 WP_000571108.1.91297 WP_000571108.1.9130 WP_000571108.1.91300 WP_000571108.1.91310 WP_000571108.1.91316 WP_000571108.1.91332 WP_000571108.1.91346 WP_000571108.1.91357 WP_000571108.1.91364 WP_000571108.1.91371 WP_000571108.1.91380 WP_000571108.1.91382 WP_000571108.1.9140 WP_000571108.1.91420 WP_000571108.1.91427 WP_000571108.1.91447 WP_000571108.1.91465 WP_000571108.1.91486 WP_000571108.1.91487 WP_000571108.1.91500 WP_000571108.1.91501 WP_000571108.1.91525 WP_000571108.1.9153 WP_000571108.1.91530 WP_000571108.1.91542 WP_000571108.1.91547 WP_000571108.1.9155 WP_000571108.1.91559 WP_000571108.1.91573 WP_000571108.1.91581 WP_000571108.1.91586 WP_000571108.1.91587 WP_000571108.1.91591 WP_000571108.1.91611 WP_000571108.1.91624 WP_000571108.1.91629 WP_000571108.1.91634 WP_000571108.1.91635 WP_000571108.1.91639 WP_000571108.1.91660 WP_000571108.1.91670 WP_000571108.1.917 WP_000571108.1.91704 WP_000571108.1.91745 WP_000571108.1.91746 WP_000571108.1.91749 WP_000571108.1.91771 WP_000571108.1.91781 WP_000571108.1.91791 WP_000571108.1.91800 WP_000571108.1.91816 WP_000571108.1.91829 WP_000571108.1.91848 WP_000571108.1.91895 WP_000571108.1.91909 WP_000571108.1.91911 WP_000571108.1.91918 WP_000571108.1.91919 WP_000571108.1.91928 WP_000571108.1.91950 WP_000571108.1.91955 WP_000571108.1.91969 WP_000571108.1.92 WP_000571108.1.92057 WP_000571108.1.92104 WP_000571108.1.92110 WP_000571108.1.92125 WP_000571108.1.92133 WP_000571108.1.92140 WP_000571108.1.92147 WP_000571108.1.92158 WP_000571108.1.92164 WP_000571108.1.92169 WP_000571108.1.92173 WP_000571108.1.92185 WP_000571108.1.92186 WP_000571108.1.92196 WP_000571108.1.92212 WP_000571108.1.92218 WP_000571108.1.92227 WP_000571108.1.92228 WP_000571108.1.9224 WP_000571108.1.92244 WP_000571108.1.92249 WP_000571108.1.92253 WP_000571108.1.92259 WP_000571108.1.92278 WP_000571108.1.92297 WP_000571108.1.92303 WP_000571108.1.92324 WP_000571108.1.9234 WP_000571108.1.9237 WP_000571108.1.9239 WP_000571108.1.92391 WP_000571108.1.92398 WP_000571108.1.92405 WP_000571108.1.92415 WP_000571108.1.92424 WP_000571108.1.92425 WP_000571108.1.92436 WP_000571108.1.92442 WP_000571108.1.9247 WP_000571108.1.92479 WP_000571108.1.92497 WP_000571108.1.92500 WP_000571108.1.92512 WP_000571108.1.92520 WP_000571108.1.92534 WP_000571108.1.92541 WP_000571108.1.92544 WP_000571108.1.92546 WP_000571108.1.92560 WP_000571108.1.92565 WP_000571108.1.92602 WP_000571108.1.92607 WP_000571108.1.92667 WP_000571108.1.92674 WP_000571108.1.92679 WP_000571108.1.92688 WP_000571108.1.92691 WP_000571108.1.92718 WP_000571108.1.92723 WP_000571108.1.92726 WP_000571108.1.92735 WP_000571108.1.92741 WP_000571108.1.92765 WP_000571108.1.92772 WP_000571108.1.92773 WP_000571108.1.92789 WP_000571108.1.92795 WP_000571108.1.92805 WP_000571108.1.92840 WP_000571108.1.92848 WP_000571108.1.92849 WP_000571108.1.9286 WP_000571108.1.92862 WP_000571108.1.92864 WP_000571108.1.92897 WP_000571108.1.9293 WP_000571108.1.92937 WP_000571108.1.92950 WP_000571108.1.9296 WP_000571108.1.92965 WP_000571108.1.9298 WP_000571108.1.92997 WP_000571108.1.93041 WP_000571108.1.93047 WP_000571108.1.9305 WP_000571108.1.93068 WP_000571108.1.93071 WP_000571108.1.93074 WP_000571108.1.93078 WP_000571108.1.93125 WP_000571108.1.93147 WP_000571108.1.93163 WP_000571108.1.93176 WP_000571108.1.93186 WP_000571108.1.93191 WP_000571108.1.93197 WP_000571108.1.93198 WP_000571108.1.93224 WP_000571108.1.93231 WP_000571108.1.93237 WP_000571108.1.93243 WP_000571108.1.93251 WP_000571108.1.93254 WP_000571108.1.93260 WP_000571108.1.93263 WP_000571108.1.9330 WP_000571108.1.93300 WP_000571108.1.93316 WP_000571108.1.93329 WP_000571108.1.93336 WP_000571108.1.93354 WP_000571108.1.93374 WP_000571108.1.93378 WP_000571108.1.93416 WP_000571108.1.93435 WP_000571108.1.93438 WP_000571108.1.93444 WP_000571108.1.9346 WP_000571108.1.93471 WP_000571108.1.93492 WP_000571108.1.93514 WP_000571108.1.9352 WP_000571108.1.93538 WP_000571108.1.9354 WP_000571108.1.93561 WP_000571108.1.93567 WP_000571108.1.93579 WP_000571108.1.9358 WP_000571108.1.93590 WP_000571108.1.93647 WP_000571108.1.93658 WP_000571108.1.93669 WP_000571108.1.93678 WP_000571108.1.93690 WP_000571108.1.93708 WP_000571108.1.93710 WP_000571108.1.93722 WP_000571108.1.93738 WP_000571108.1.93758 WP_000571108.1.93762 WP_000571108.1.93769 WP_000571108.1.93775 WP_000571108.1.93787 WP_000571108.1.93862 WP_000571108.1.9387 WP_000571108.1.93882 WP_000571108.1.93883 WP_000571108.1.93890 WP_000571108.1.93891 WP_000571108.1.9392 WP_000571108.1.93934 WP_000571108.1.93972 WP_000571108.1.93975 WP_000571108.1.93976 WP_000571108.1.9398 WP_000571108.1.93981 WP_000571108.1.94 WP_000571108.1.94009 WP_000571108.1.94016 WP_000571108.1.94053 WP_000571108.1.94060 WP_000571108.1.94074 WP_000571108.1.94080 WP_000571108.1.94082 WP_000571108.1.94087 WP_000571108.1.94093 WP_000571108.1.94096 WP_000571108.1.94114 WP_000571108.1.94119 WP_000571108.1.94122 WP_000571108.1.94123 WP_000571108.1.94130 WP_000571108.1.94165 WP_000571108.1.94172 WP_000571108.1.94182 WP_000571108.1.94209 WP_000571108.1.94229 WP_000571108.1.94242 WP_000571108.1.94245 WP_000571108.1.94248 WP_000571108.1.94268 WP_000571108.1.94287 WP_000571108.1.94293 WP_000571108.1.94294 WP_000571108.1.9430 WP_000571108.1.94319 WP_000571108.1.94320 WP_000571108.1.94324 WP_000571108.1.94335 WP_000571108.1.94337 WP_000571108.1.94340 WP_000571108.1.94341 WP_000571108.1.94345 WP_000571108.1.9435 WP_000571108.1.9437 WP_000571108.1.94374 WP_000571108.1.94375 WP_000571108.1.94376 WP_000571108.1.94389 WP_000571108.1.94407 WP_000571108.1.94409 WP_000571108.1.94423 WP_000571108.1.94484 WP_000571108.1.94505 WP_000571108.1.94530 WP_000571108.1.94536 WP_000571108.1.94549 WP_000571108.1.9455 WP_000571108.1.94550 WP_000571108.1.94576 WP_000571108.1.94625 WP_000571108.1.94636 WP_000571108.1.9464 WP_000571108.1.94641 WP_000571108.1.94684 WP_000571108.1.94688 WP_000571108.1.947 WP_000571108.1.94719 WP_000571108.1.94733 WP_000571108.1.94741 WP_000571108.1.94789 WP_000571108.1.94797 WP_000571108.1.94825 WP_000571108.1.94838 WP_000571108.1.94844 WP_000571108.1.94845 WP_000571108.1.9485 WP_000571108.1.94857 WP_000571108.1.94866 WP_000571108.1.94941 WP_000571108.1.9495 WP_000571108.1.94958 WP_000571108.1.94969 WP_000571108.1.9497 WP_000571108.1.94980 WP_000571108.1.94989 WP_000571108.1.94992 WP_000571108.1.94999 WP_000571108.1.95002 WP_000571108.1.95008 WP_000571108.1.95014 WP_000571108.1.95023 WP_000571108.1.95029 WP_000571108.1.95033 WP_000571108.1.95038 WP_000571108.1.95049 WP_000571108.1.95077 WP_000571108.1.95090 WP_000571108.1.9510 WP_000571108.1.95120 WP_000571108.1.95154 WP_000571108.1.95156 WP_000571108.1.95174 WP_000571108.1.95193 WP_000571108.1.95210 WP_000571108.1.95263 WP_000571108.1.95281 WP_000571108.1.95294 WP_000571108.1.95304 WP_000571108.1.95307 WP_000571108.1.95327 WP_000571108.1.95342 WP_000571108.1.95361 WP_000571108.1.95372 WP_000571108.1.9538 WP_000571108.1.95386 WP_000571108.1.95409 WP_000571108.1.95415 WP_000571108.1.9544 WP_000571108.1.95442 WP_000571108.1.95452 WP_000571108.1.95476 WP_000571108.1.95494 WP_000571108.1.95495 WP_000571108.1.95500 WP_000571108.1.95505 WP_000571108.1.95512 WP_000571108.1.95519 WP_000571108.1.95522 WP_000571108.1.95535 WP_000571108.1.95537 WP_000571108.1.95545 WP_000571108.1.95552 WP_000571108.1.95560 WP_000571108.1.9557 WP_000571108.1.95571 WP_000571108.1.95581 WP_000571108.1.95603 WP_000571108.1.9563 WP_000571108.1.95631 WP_000571108.1.95639 WP_000571108.1.95640 WP_000571108.1.95681 WP_000571108.1.95683 WP_000571108.1.95699 WP_000571108.1.95704 WP_000571108.1.95713 WP_000571108.1.95714 WP_000571108.1.95737 WP_000571108.1.95760 WP_000571108.1.95780 WP_000571108.1.95781 WP_000571108.1.95804 WP_000571108.1.95806 WP_000571108.1.95832 WP_000571108.1.95877 WP_000571108.1.95885 WP_000571108.1.959 WP_000571108.1.95914 WP_000571108.1.95918 WP_000571108.1.95947 WP_000571108.1.95954 WP_000571108.1.95962 WP_000571108.1.95983 WP_000571108.1.95986 WP_000571108.1.95997 WP_000571108.1.96014 WP_000571108.1.96022 WP_000571108.1.96030 WP_000571108.1.96056 WP_000571108.1.96057 WP_000571108.1.96067 WP_000571108.1.96075 WP_000571108.1.96105 WP_000571108.1.96133 WP_000571108.1.96135 WP_000571108.1.96148 WP_000571108.1.96160 WP_000571108.1.96163 WP_000571108.1.96200 WP_000571108.1.96209 WP_000571108.1.96218 WP_000571108.1.96221 WP_000571108.1.96228 WP_000571108.1.96255 WP_000571108.1.96261 WP_000571108.1.96271 WP_000571108.1.96283 WP_000571108.1.96297 WP_000571108.1.96301 WP_000571108.1.96305 WP_000571108.1.96312 WP_000571108.1.96314 WP_000571108.1.96316 WP_000571108.1.96322 WP_000571108.1.96362 WP_000571108.1.96364 WP_000571108.1.96368 WP_000571108.1.96412 WP_000571108.1.96424 WP_000571108.1.96433 WP_000571108.1.96468 WP_000571108.1.96472 WP_000571108.1.96474 WP_000571108.1.96477 WP_000571108.1.96489 WP_000571108.1.96495 WP_000571108.1.9650 WP_000571108.1.96509 WP_000571108.1.96535 WP_000571108.1.96538 WP_000571108.1.96550 WP_000571108.1.96554 WP_000571108.1.96566 WP_000571108.1.96568 WP_000571108.1.96578 WP_000571108.1.96591 WP_000571108.1.96603 WP_000571108.1.96613 WP_000571108.1.96634 WP_000571108.1.96637 WP_000571108.1.96638 WP_000571108.1.96646 WP_000571108.1.96654 WP_000571108.1.96663 WP_000571108.1.96678 WP_000571108.1.96688 WP_000571108.1.96699 WP_000571108.1.96705 WP_000571108.1.96718 WP_000571108.1.96727 WP_000571108.1.9675 WP_000571108.1.96770 WP_000571108.1.96780 WP_000571108.1.96804 WP_000571108.1.96836 WP_000571108.1.9684 WP_000571108.1.96855 WP_000571108.1.96856 WP_000571108.1.96859 WP_000571108.1.96866 WP_000571108.1.96882 WP_000571108.1.96892 WP_000571108.1.96895 WP_000571108.1.96918 WP_000571108.1.96922 WP_000571108.1.9695 WP_000571108.1.96956 WP_000571108.1.96965 WP_000571108.1.96969 WP_000571108.1.96970 WP_000571108.1.96976 WP_000571108.1.96985 WP_000571108.1.96997 WP_000571108.1.97000 WP_000571108.1.97001 WP_000571108.1.97004 WP_000571108.1.97007 WP_000571108.1.97014 WP_000571108.1.97017 WP_000571108.1.97019 WP_000571108.1.97029 WP_000571108.1.97033 WP_000571108.1.97034 WP_000571108.1.97072 WP_000571108.1.97077 WP_000571108.1.97117 WP_000571108.1.97138 WP_000571108.1.97139 WP_000571108.1.97141 WP_000571108.1.97146 WP_000571108.1.97151 WP_000571108.1.97161 WP_000571108.1.97164 WP_000571108.1.97191 WP_000571108.1.97205 WP_000571108.1.97206 WP_000571108.1.97228 WP_000571108.1.97230 WP_000571108.1.97234 WP_000571108.1.97241 WP_000571108.1.97256 WP_000571108.1.97267 WP_000571108.1.97276 WP_000571108.1.97293 WP_000571108.1.97295 WP_000571108.1.97302 WP_000571108.1.97311 WP_000571108.1.97312 WP_000571108.1.97336 WP_000571108.1.97348 WP_000571108.1.97352 WP_000571108.1.97355 WP_000571108.1.97367 WP_000571108.1.9737 WP_000571108.1.97392 WP_000571108.1.97399 WP_000571108.1.97409 WP_000571108.1.97411 WP_000571108.1.97427 WP_000571108.1.97450 WP_000571108.1.97456 WP_000571108.1.97460 WP_000571108.1.97468 WP_000571108.1.9748 WP_000571108.1.97494 WP_000571108.1.97530 WP_000571108.1.97531 WP_000571108.1.97536 WP_000571108.1.97537 WP_000571108.1.97574 WP_000571108.1.97575 WP_000571108.1.97576 WP_000571108.1.9758 WP_000571108.1.97585 WP_000571108.1.97590 WP_000571108.1.97627 WP_000571108.1.97641 WP_000571108.1.97664 WP_000571108.1.97687 WP_000571108.1.97688 WP_000571108.1.97696 WP_000571108.1.97699 WP_000571108.1.97706 WP_000571108.1.97720 WP_000571108.1.97731 WP_000571108.1.97739 WP_000571108.1.97742 WP_000571108.1.97744 WP_000571108.1.97746 WP_000571108.1.97758 WP_000571108.1.97762 WP_000571108.1.97763 WP_000571108.1.97776 WP_000571108.1.97786 WP_000571108.1.97827 WP_000571108.1.97835 WP_000571108.1.9788 WP_000571108.1.9789 WP_000571108.1.97898 WP_000571108.1.97899 WP_000571108.1.97928 WP_000571108.1.97935 WP_000571108.1.97953 WP_000571108.1.97955 WP_000571108.1.97974 WP_000571108.1.97997 WP_000571108.1.97999 WP_000571108.1.98008 WP_000571108.1.98011 WP_000571108.1.98033 WP_000571108.1.98051 WP_000571108.1.98054 WP_000571108.1.98058 WP_000571108.1.98073 WP_000571108.1.98077 WP_000571108.1.98131 WP_000571108.1.98161 WP_000571108.1.98174 WP_000571108.1.98179 WP_000571108.1.98191 WP_000571108.1.98195 WP_000571108.1.98233 WP_000571108.1.98242 WP_000571108.1.98248 WP_000571108.1.98249 WP_000571108.1.98281 WP_000571108.1.98295 WP_000571108.1.98322 WP_000571108.1.98328 WP_000571108.1.98352 WP_000571108.1.98353 WP_000571108.1.98359 WP_000571108.1.98360 WP_000571108.1.98361 WP_000571108.1.98366 WP_000571108.1.98372 WP_000571108.1.98379 WP_000571108.1.98387 WP_000571108.1.98409 WP_000571108.1.98411 WP_000571108.1.98415 WP_000571108.1.98419 WP_000571108.1.98425 WP_000571108.1.98456 WP_000571108.1.98501 WP_000571108.1.98506 WP_000571108.1.98510 WP_000571108.1.98512 WP_000571108.1.98533 WP_000571108.1.98548 WP_000571108.1.98552 WP_000571108.1.98559 WP_000571108.1.98585 WP_000571108.1.98586 WP_000571108.1.986 WP_000571108.1.98609 WP_000571108.1.98655 WP_000571108.1.98659 WP_000571108.1.98667 WP_000571108.1.98703 WP_000571108.1.98706 WP_000571108.1.98710 WP_000571108.1.9872 WP_000571108.1.98723 WP_000571108.1.98730 WP_000571108.1.98734 WP_000571108.1.98741 WP_000571108.1.98750 WP_000571108.1.98767 WP_000571108.1.98786 WP_000571108.1.98797 WP_000571108.1.98805 WP_000571108.1.98807 WP_000571108.1.98821 WP_000571108.1.98825 WP_000571108.1.98837 WP_000571108.1.98842 WP_000571108.1.98858 WP_000571108.1.98865 WP_000571108.1.98874 WP_000571108.1.98880 WP_000571108.1.98883 WP_000571108.1.98894 WP_000571108.1.98912 WP_000571108.1.98924 WP_000571108.1.98967 WP_000571108.1.98978 WP_000571108.1.98981 WP_000571108.1.98985 WP_000571108.1.99009 WP_000571108.1.99025 WP_000571108.1.99027 WP_000571108.1.99081 WP_000571108.1.99090 WP_000571108.1.991 WP_000571108.1.9910 WP_000571108.1.9912 WP_000571108.1.99136 WP_000571108.1.99155 WP_000571108.1.99171 WP_000571108.1.99174 WP_000571108.1.99183 WP_000571108.1.99195 WP_000571108.1.99207 WP_000571108.1.99228 WP_000571108.1.99249 WP_000571108.1.99262 WP_000571108.1.99280 WP_000571108.1.99283 WP_000571108.1.99308 WP_000571108.1.99311 WP_000571108.1.99331 WP_000571108.1.99359 WP_000571108.1.9936 WP_000571108.1.99394 WP_000571108.1.99405 WP_000571108.1.99414 WP_000571108.1.99418 WP_000571108.1.99430 WP_000571108.1.99459 WP_000571108.1.99492 WP_000571108.1.99494 WP_000571108.1.99509 WP_000571108.1.99519 WP_000571108.1.99523 WP_000571108.1.99524 WP_000571108.1.99525 WP_000571108.1.99536 WP_000571108.1.99538 WP_000571108.1.99564 WP_000571108.1.99569 WP_000571108.1.9960 WP_000571108.1.99631 WP_000571108.1.99638 WP_000571108.1.9965 WP_000571108.1.99683 WP_000571108.1.99686 WP_000571108.1.99688 WP_000571108.1.99714 WP_000571108.1.9974 WP_000571108.1.99759 WP_000571108.1.99768 WP_000571108.1.99777 WP_000571108.1.99802 WP_000571108.1.99830 WP_000571108.1.99849 WP_000571108.1.9985 WP_000571108.1.99850 WP_000571108.1.99859 WP_000571108.1.99860 WP_000571108.1.99862 WP_000571108.1.9987 WP_000571108.1.99884 WP_000571108.1.99888 WP_000571108.1.99926 WP_000571108.1.99950 WP_000571108.1.99954 WP_000571108.1.99955 WP_000571108.1.99956 WP_000571108.1.99963 WP_000571108.1.99979 WP_000571108.1.99984 WP_000571108.1.99985 WP_000571108.1.99999 YP_500115.1.76163 gi|269203134|ref|YP_003282403.1| gi|470191386|ref|YP_007577696.1| 359786.SaurJH9_1563 359787.SaurJH1_1594 426430.NWMN_1413 451515.SAUSA300_1455 451516.USA300HOU_1508 681288.SAAV_1497 93061.SAOUHSC_01600 93062.SACOL1550 jgi|Aspzo1|143131|fgenesh1_pg.9_#_190 gi|151221625|ref|YP_001332447.1| gi|521212324|ref|YP_008168670.1| gi|537461199|ref|YP_008491639.1| gi|470195317|ref|YP_007581669.1| gi|532359600|ref|YP_008449429.1| gi|470199250|ref|YP_007585650.1| gi|470219019|ref|YP_007619413.1| gi|88195311|ref|YP_500115.1| gi|161509735|ref|YP_001575394.1| gi|404478856|ref|YP_006710286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]