SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150394088|ref|YP_001316763.1| from Staphylococcus aureus subsp. aureus JH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150394088|ref|YP_001316763.1|
Domain Number 1 Region: 4-281
Classification Level Classification E-value
Superfamily Folate-binding domain 5.02e-95
Family Aminomethyltransferase folate-binding domain 0.000000254
Further Details:      
 
Domain Number 2 Region: 273-359
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.47e-22
Family Aminomethyltransferase beta-barrel domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150394088|ref|YP_001316763.1|
Sequence length 363
Comment glycine cleavage system aminomethyltransferase T [Staphylococcus aureus subsp. aureus JH1]
Sequence
MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
IDK
Download sequence
Identical sequences A0A0E0VPD8 A0A0E1VGU8 A0A1B3YPK9 A0A1E8X2Y1 A0A2H5AP29 A0A2K4BHT1 A5IT65 A6QH81 A6U208 A7X2S3 A8Z476 P64224 P64225 P64226 Q2FGI5 Q2FY33 Q5HFM2 Q6G929 T1YA92 W8TW08
gi|470219041|ref|YP_007619435.1| gi|379014745|ref|YP_005290981.1| gi|537461231|ref|YP_008491671.1| gi|21283218|ref|NP_646306.1| gi|151221653|ref|YP_001332475.1| WP_000093349.1.100013 WP_000093349.1.100041 WP_000093349.1.100049 WP_000093349.1.100057 WP_000093349.1.10006 WP_000093349.1.100067 WP_000093349.1.100088 WP_000093349.1.100094 WP_000093349.1.100122 WP_000093349.1.10014 WP_000093349.1.100154 WP_000093349.1.100171 WP_000093349.1.100180 WP_000093349.1.100184 WP_000093349.1.100189 WP_000093349.1.100235 WP_000093349.1.100265 WP_000093349.1.100272 WP_000093349.1.100298 WP_000093349.1.100307 WP_000093349.1.10032 WP_000093349.1.100347 WP_000093349.1.100366 WP_000093349.1.100391 WP_000093349.1.100399 WP_000093349.1.10041 WP_000093349.1.100452 WP_000093349.1.10046 WP_000093349.1.100464 WP_000093349.1.10050 WP_000093349.1.10053 WP_000093349.1.100534 WP_000093349.1.100535 WP_000093349.1.100582 WP_000093349.1.100596 WP_000093349.1.100612 WP_000093349.1.100618 WP_000093349.1.100631 WP_000093349.1.100647 WP_000093349.1.100668 WP_000093349.1.100678 WP_000093349.1.100693 WP_000093349.1.100699 WP_000093349.1.100704 WP_000093349.1.100719 WP_000093349.1.100726 WP_000093349.1.100761 WP_000093349.1.100768 WP_000093349.1.100823 WP_000093349.1.100832 WP_000093349.1.100834 WP_000093349.1.100903 WP_000093349.1.100920 WP_000093349.1.100922 WP_000093349.1.100934 WP_000093349.1.100963 WP_000093349.1.10097 WP_000093349.1.100981 WP_000093349.1.100987 WP_000093349.1.101002 WP_000093349.1.101017 WP_000093349.1.101019 WP_000093349.1.101027 WP_000093349.1.101055 WP_000093349.1.101058 WP_000093349.1.101068 WP_000093349.1.101071 WP_000093349.1.101072 WP_000093349.1.101084 WP_000093349.1.101103 WP_000093349.1.10111 WP_000093349.1.101142 WP_000093349.1.101160 WP_000093349.1.101177 WP_000093349.1.101192 WP_000093349.1.101217 WP_000093349.1.101240 WP_000093349.1.101262 WP_000093349.1.101266 WP_000093349.1.101327 WP_000093349.1.101329 WP_000093349.1.101330 WP_000093349.1.101352 WP_000093349.1.101375 WP_000093349.1.101379 WP_000093349.1.101393 WP_000093349.1.101406 WP_000093349.1.101414 WP_000093349.1.101440 WP_000093349.1.101441 WP_000093349.1.10148 WP_000093349.1.101490 WP_000093349.1.101495 WP_000093349.1.101505 WP_000093349.1.101531 WP_000093349.1.101566 WP_000093349.1.101567 WP_000093349.1.101570 WP_000093349.1.101598 WP_000093349.1.101615 WP_000093349.1.101617 WP_000093349.1.10165 WP_000093349.1.10166 WP_000093349.1.101661 WP_000093349.1.101670 WP_000093349.1.101691 WP_000093349.1.101704 WP_000093349.1.101725 WP_000093349.1.101728 WP_000093349.1.101745 WP_000093349.1.101778 WP_000093349.1.101788 WP_000093349.1.101813 WP_000093349.1.101820 WP_000093349.1.101821 WP_000093349.1.101825 WP_000093349.1.101852 WP_000093349.1.101902 WP_000093349.1.101906 WP_000093349.1.101943 WP_000093349.1.101950 WP_000093349.1.101999 WP_000093349.1.102065 WP_000093349.1.102066 WP_000093349.1.102070 WP_000093349.1.102084 WP_000093349.1.10209 WP_000093349.1.102096 WP_000093349.1.102123 WP_000093349.1.102126 WP_000093349.1.102130 WP_000093349.1.102132 WP_000093349.1.1022 WP_000093349.1.10238 WP_000093349.1.1025 WP_000093349.1.10274 WP_000093349.1.10301 WP_000093349.1.10306 WP_000093349.1.10308 WP_000093349.1.1031 WP_000093349.1.10343 WP_000093349.1.10355 WP_000093349.1.10358 WP_000093349.1.10397 WP_000093349.1.1043 WP_000093349.1.10431 WP_000093349.1.10436 WP_000093349.1.10469 WP_000093349.1.10478 WP_000093349.1.10481 WP_000093349.1.10503 WP_000093349.1.10526 WP_000093349.1.10542 WP_000093349.1.10543 WP_000093349.1.10565 WP_000093349.1.1060 WP_000093349.1.10614 WP_000093349.1.10617 WP_000093349.1.10624 WP_000093349.1.10679 WP_000093349.1.10707 WP_000093349.1.10726 WP_000093349.1.10742 WP_000093349.1.10749 WP_000093349.1.10751 WP_000093349.1.1077 WP_000093349.1.10785 WP_000093349.1.10823 WP_000093349.1.10843 WP_000093349.1.10858 WP_000093349.1.10919 WP_000093349.1.10928 WP_000093349.1.10942 WP_000093349.1.10950 WP_000093349.1.10976 WP_000093349.1.10979 WP_000093349.1.11001 WP_000093349.1.11069 WP_000093349.1.11073 WP_000093349.1.11083 WP_000093349.1.11084 WP_000093349.1.11129 WP_000093349.1.1115 WP_000093349.1.11162 WP_000093349.1.11188 WP_000093349.1.1120 WP_000093349.1.11220 WP_000093349.1.11223 WP_000093349.1.1124 WP_000093349.1.11261 WP_000093349.1.11281 WP_000093349.1.11282 WP_000093349.1.11286 WP_000093349.1.11287 WP_000093349.1.11294 WP_000093349.1.11322 WP_000093349.1.11333 WP_000093349.1.11348 WP_000093349.1.11353 WP_000093349.1.11377 WP_000093349.1.11378 WP_000093349.1.11403 WP_000093349.1.11407 WP_000093349.1.11447 WP_000093349.1.11451 WP_000093349.1.11463 WP_000093349.1.1147 WP_000093349.1.11475 WP_000093349.1.11488 WP_000093349.1.11492 WP_000093349.1.11504 WP_000093349.1.11513 WP_000093349.1.11525 WP_000093349.1.11556 WP_000093349.1.11558 WP_000093349.1.11592 WP_000093349.1.11611 WP_000093349.1.11640 WP_000093349.1.11646 WP_000093349.1.11660 WP_000093349.1.11663 WP_000093349.1.11665 WP_000093349.1.11692 WP_000093349.1.117 WP_000093349.1.1171 WP_000093349.1.11719 WP_000093349.1.11720 WP_000093349.1.11730 WP_000093349.1.11736 WP_000093349.1.11741 WP_000093349.1.11768 WP_000093349.1.11781 WP_000093349.1.11794 WP_000093349.1.11795 WP_000093349.1.11829 WP_000093349.1.11837 WP_000093349.1.11903 WP_000093349.1.11919 WP_000093349.1.11991 WP_000093349.1.12005 WP_000093349.1.12019 WP_000093349.1.12042 WP_000093349.1.1205 WP_000093349.1.12073 WP_000093349.1.12098 WP_000093349.1.1210 WP_000093349.1.12123 WP_000093349.1.12137 WP_000093349.1.12149 WP_000093349.1.12152 WP_000093349.1.12170 WP_000093349.1.12175 WP_000093349.1.12181 WP_000093349.1.12233 WP_000093349.1.12234 WP_000093349.1.12256 WP_000093349.1.12272 WP_000093349.1.12297 WP_000093349.1.12328 WP_000093349.1.12330 WP_000093349.1.12361 WP_000093349.1.12366 WP_000093349.1.12391 WP_000093349.1.12436 WP_000093349.1.12437 WP_000093349.1.12447 WP_000093349.1.12498 WP_000093349.1.12508 WP_000093349.1.1257 WP_000093349.1.12598 WP_000093349.1.12605 WP_000093349.1.12608 WP_000093349.1.12618 WP_000093349.1.12639 WP_000093349.1.12685 WP_000093349.1.12705 WP_000093349.1.12707 WP_000093349.1.12715 WP_000093349.1.12733 WP_000093349.1.12737 WP_000093349.1.12771 WP_000093349.1.12780 WP_000093349.1.12788 WP_000093349.1.12822 WP_000093349.1.12829 WP_000093349.1.12833 WP_000093349.1.12845 WP_000093349.1.12858 WP_000093349.1.12884 WP_000093349.1.12903 WP_000093349.1.12904 WP_000093349.1.12918 WP_000093349.1.12920 WP_000093349.1.12937 WP_000093349.1.12938 WP_000093349.1.12951 WP_000093349.1.13013 WP_000093349.1.13039 WP_000093349.1.13062 WP_000093349.1.13072 WP_000093349.1.13091 WP_000093349.1.13104 WP_000093349.1.13112 WP_000093349.1.13154 WP_000093349.1.13169 WP_000093349.1.13170 WP_000093349.1.13189 WP_000093349.1.13243 WP_000093349.1.13250 WP_000093349.1.13317 WP_000093349.1.13322 WP_000093349.1.13326 WP_000093349.1.13355 WP_000093349.1.13366 WP_000093349.1.13376 WP_000093349.1.13379 WP_000093349.1.13405 WP_000093349.1.13448 WP_000093349.1.13468 WP_000093349.1.1347 WP_000093349.1.13486 WP_000093349.1.13514 WP_000093349.1.13531 WP_000093349.1.13554 WP_000093349.1.13556 WP_000093349.1.13568 WP_000093349.1.13612 WP_000093349.1.13617 WP_000093349.1.13654 WP_000093349.1.13665 WP_000093349.1.13668 WP_000093349.1.13670 WP_000093349.1.13683 WP_000093349.1.13727 WP_000093349.1.13728 WP_000093349.1.13733 WP_000093349.1.1374 WP_000093349.1.13755 WP_000093349.1.13757 WP_000093349.1.13769 WP_000093349.1.13772 WP_000093349.1.13804 WP_000093349.1.13805 WP_000093349.1.13870 WP_000093349.1.13879 WP_000093349.1.13884 WP_000093349.1.13897 WP_000093349.1.13914 WP_000093349.1.13933 WP_000093349.1.13940 WP_000093349.1.13948 WP_000093349.1.13983 WP_000093349.1.13986 WP_000093349.1.13987 WP_000093349.1.14025 WP_000093349.1.14076 WP_000093349.1.14112 WP_000093349.1.14143 WP_000093349.1.14153 WP_000093349.1.14163 WP_000093349.1.1418 WP_000093349.1.1420 WP_000093349.1.14201 WP_000093349.1.14233 WP_000093349.1.1426 WP_000093349.1.14298 WP_000093349.1.14305 WP_000093349.1.14337 WP_000093349.1.14342 WP_000093349.1.14349 WP_000093349.1.14358 WP_000093349.1.14363 WP_000093349.1.14364 WP_000093349.1.14366 WP_000093349.1.14394 WP_000093349.1.14397 WP_000093349.1.14412 WP_000093349.1.14418 WP_000093349.1.14475 WP_000093349.1.14535 WP_000093349.1.1457 WP_000093349.1.14577 WP_000093349.1.14596 WP_000093349.1.14665 WP_000093349.1.14681 WP_000093349.1.14696 WP_000093349.1.147 WP_000093349.1.1471 WP_000093349.1.14729 WP_000093349.1.14734 WP_000093349.1.14744 WP_000093349.1.14747 WP_000093349.1.1477 WP_000093349.1.14770 WP_000093349.1.14774 WP_000093349.1.14782 WP_000093349.1.14790 WP_000093349.1.14809 WP_000093349.1.14825 WP_000093349.1.14846 WP_000093349.1.14869 WP_000093349.1.14874 WP_000093349.1.14888 WP_000093349.1.14902 WP_000093349.1.14924 WP_000093349.1.14967 WP_000093349.1.14970 WP_000093349.1.14987 WP_000093349.1.15000 WP_000093349.1.15015 WP_000093349.1.15029 WP_000093349.1.15071 WP_000093349.1.15091 WP_000093349.1.15098 WP_000093349.1.15108 WP_000093349.1.15150 WP_000093349.1.15173 WP_000093349.1.15185 WP_000093349.1.1520 WP_000093349.1.15201 WP_000093349.1.15206 WP_000093349.1.15241 WP_000093349.1.1525 WP_000093349.1.15255 WP_000093349.1.15263 WP_000093349.1.15268 WP_000093349.1.15269 WP_000093349.1.15278 WP_000093349.1.15294 WP_000093349.1.15296 WP_000093349.1.15329 WP_000093349.1.15389 WP_000093349.1.15399 WP_000093349.1.15403 WP_000093349.1.15409 WP_000093349.1.15421 WP_000093349.1.15438 WP_000093349.1.1545 WP_000093349.1.15478 WP_000093349.1.15489 WP_000093349.1.15505 WP_000093349.1.15507 WP_000093349.1.15524 WP_000093349.1.15532 WP_000093349.1.15533 WP_000093349.1.15544 WP_000093349.1.15546 WP_000093349.1.15572 WP_000093349.1.1558 WP_000093349.1.15590 WP_000093349.1.15591 WP_000093349.1.1564 WP_000093349.1.15679 WP_000093349.1.15687 WP_000093349.1.15691 WP_000093349.1.15706 WP_000093349.1.15722 WP_000093349.1.15785 WP_000093349.1.1579 WP_000093349.1.15812 WP_000093349.1.15818 WP_000093349.1.15819 WP_000093349.1.1583 WP_000093349.1.15838 WP_000093349.1.15883 WP_000093349.1.15888 WP_000093349.1.15892 WP_000093349.1.15897 WP_000093349.1.15898 WP_000093349.1.159 WP_000093349.1.15920 WP_000093349.1.15921 WP_000093349.1.15925 WP_000093349.1.15928 WP_000093349.1.15948 WP_000093349.1.15972 WP_000093349.1.16018 WP_000093349.1.1606 WP_000093349.1.16068 WP_000093349.1.16096 WP_000093349.1.16098 WP_000093349.1.16112 WP_000093349.1.16114 WP_000093349.1.16140 WP_000093349.1.16157 WP_000093349.1.16173 WP_000093349.1.16195 WP_000093349.1.16203 WP_000093349.1.16213 WP_000093349.1.16223 WP_000093349.1.1623 WP_000093349.1.16237 WP_000093349.1.16251 WP_000093349.1.16265 WP_000093349.1.16276 WP_000093349.1.16311 WP_000093349.1.16362 WP_000093349.1.16395 WP_000093349.1.16399 WP_000093349.1.16407 WP_000093349.1.16417 WP_000093349.1.16436 WP_000093349.1.16458 WP_000093349.1.16478 WP_000093349.1.16554 WP_000093349.1.16569 WP_000093349.1.16589 WP_000093349.1.16603 WP_000093349.1.16617 WP_000093349.1.16628 WP_000093349.1.16632 WP_000093349.1.16639 WP_000093349.1.1665 WP_000093349.1.16651 WP_000093349.1.16653 WP_000093349.1.16672 WP_000093349.1.16688 WP_000093349.1.16693 WP_000093349.1.16703 WP_000093349.1.16747 WP_000093349.1.16761 WP_000093349.1.16768 WP_000093349.1.16770 WP_000093349.1.16776 WP_000093349.1.16794 WP_000093349.1.16815 WP_000093349.1.16824 WP_000093349.1.16882 WP_000093349.1.16892 WP_000093349.1.16920 WP_000093349.1.16925 WP_000093349.1.16946 WP_000093349.1.16969 WP_000093349.1.170 WP_000093349.1.17009 WP_000093349.1.17012 WP_000093349.1.17038 WP_000093349.1.17046 WP_000093349.1.17050 WP_000093349.1.17080 WP_000093349.1.17104 WP_000093349.1.17122 WP_000093349.1.17132 WP_000093349.1.17137 WP_000093349.1.17139 WP_000093349.1.17143 WP_000093349.1.17157 WP_000093349.1.17169 WP_000093349.1.17176 WP_000093349.1.17180 WP_000093349.1.17201 WP_000093349.1.17210 WP_000093349.1.17231 WP_000093349.1.17234 WP_000093349.1.17240 WP_000093349.1.17249 WP_000093349.1.17256 WP_000093349.1.1729 WP_000093349.1.17309 WP_000093349.1.17320 WP_000093349.1.17327 WP_000093349.1.1736 WP_000093349.1.1740 WP_000093349.1.1741 WP_000093349.1.17419 WP_000093349.1.17450 WP_000093349.1.17454 WP_000093349.1.17456 WP_000093349.1.17485 WP_000093349.1.17529 WP_000093349.1.1756 WP_000093349.1.17569 WP_000093349.1.17581 WP_000093349.1.17590 WP_000093349.1.17643 WP_000093349.1.1765 WP_000093349.1.17657 WP_000093349.1.17666 WP_000093349.1.17671 WP_000093349.1.17676 WP_000093349.1.17717 WP_000093349.1.17718 WP_000093349.1.17725 WP_000093349.1.17737 WP_000093349.1.17770 WP_000093349.1.17796 WP_000093349.1.17818 WP_000093349.1.17832 WP_000093349.1.17834 WP_000093349.1.17845 WP_000093349.1.17847 WP_000093349.1.17853 WP_000093349.1.17859 WP_000093349.1.17876 WP_000093349.1.17909 WP_000093349.1.17922 WP_000093349.1.17928 WP_000093349.1.17929 WP_000093349.1.17943 WP_000093349.1.17951 WP_000093349.1.17974 WP_000093349.1.17987 WP_000093349.1.18011 WP_000093349.1.18016 WP_000093349.1.18035 WP_000093349.1.18043 WP_000093349.1.18069 WP_000093349.1.18074 WP_000093349.1.18080 WP_000093349.1.18105 WP_000093349.1.18113 WP_000093349.1.18140 WP_000093349.1.18153 WP_000093349.1.18203 WP_000093349.1.18237 WP_000093349.1.18248 WP_000093349.1.18261 WP_000093349.1.18283 WP_000093349.1.1829 WP_000093349.1.18290 WP_000093349.1.18301 WP_000093349.1.18309 WP_000093349.1.18310 WP_000093349.1.18320 WP_000093349.1.1835 WP_000093349.1.18360 WP_000093349.1.18412 WP_000093349.1.18429 WP_000093349.1.18437 WP_000093349.1.18451 WP_000093349.1.1847 WP_000093349.1.18487 WP_000093349.1.18495 WP_000093349.1.18506 WP_000093349.1.18507 WP_000093349.1.1851 WP_000093349.1.18516 WP_000093349.1.18529 WP_000093349.1.18539 WP_000093349.1.18560 WP_000093349.1.18562 WP_000093349.1.18570 WP_000093349.1.18591 WP_000093349.1.18611 WP_000093349.1.18632 WP_000093349.1.18656 WP_000093349.1.18658 WP_000093349.1.18668 WP_000093349.1.18679 WP_000093349.1.18719 WP_000093349.1.18741 WP_000093349.1.18758 WP_000093349.1.18777 WP_000093349.1.18809 WP_000093349.1.18818 WP_000093349.1.18819 WP_000093349.1.18830 WP_000093349.1.18834 WP_000093349.1.18836 WP_000093349.1.18879 WP_000093349.1.18882 WP_000093349.1.18918 WP_000093349.1.1892 WP_000093349.1.18938 WP_000093349.1.18963 WP_000093349.1.18965 WP_000093349.1.18974 WP_000093349.1.18987 WP_000093349.1.18996 WP_000093349.1.19009 WP_000093349.1.1901 WP_000093349.1.19014 WP_000093349.1.19027 WP_000093349.1.19052 WP_000093349.1.19082 WP_000093349.1.19102 WP_000093349.1.19109 WP_000093349.1.1911 WP_000093349.1.19149 WP_000093349.1.19179 WP_000093349.1.192 WP_000093349.1.1921 WP_000093349.1.19272 WP_000093349.1.19301 WP_000093349.1.19306 WP_000093349.1.19322 WP_000093349.1.19375 WP_000093349.1.19377 WP_000093349.1.19399 WP_000093349.1.19411 WP_000093349.1.1943 WP_000093349.1.19430 WP_000093349.1.19444 WP_000093349.1.19450 WP_000093349.1.19509 WP_000093349.1.19537 WP_000093349.1.19577 WP_000093349.1.19611 WP_000093349.1.1962 WP_000093349.1.1964 WP_000093349.1.19643 WP_000093349.1.19700 WP_000093349.1.19701 WP_000093349.1.19725 WP_000093349.1.19732 WP_000093349.1.19733 WP_000093349.1.1974 WP_000093349.1.19748 WP_000093349.1.1975 WP_000093349.1.19759 WP_000093349.1.19765 WP_000093349.1.19775 WP_000093349.1.19792 WP_000093349.1.19816 WP_000093349.1.19848 WP_000093349.1.19881 WP_000093349.1.19891 WP_000093349.1.19912 WP_000093349.1.19921 WP_000093349.1.19980 WP_000093349.1.19982 WP_000093349.1.2 WP_000093349.1.20006 WP_000093349.1.20049 WP_000093349.1.20052 WP_000093349.1.20057 WP_000093349.1.2007 WP_000093349.1.20078 WP_000093349.1.2008 WP_000093349.1.20090 WP_000093349.1.20100 WP_000093349.1.20101 WP_000093349.1.2013 WP_000093349.1.20155 WP_000093349.1.20156 WP_000093349.1.20160 WP_000093349.1.20161 WP_000093349.1.20167 WP_000093349.1.20177 WP_000093349.1.20191 WP_000093349.1.20214 WP_000093349.1.20235 WP_000093349.1.20245 WP_000093349.1.2029 WP_000093349.1.20324 WP_000093349.1.20340 WP_000093349.1.20386 WP_000093349.1.20394 WP_000093349.1.20398 WP_000093349.1.20399 WP_000093349.1.20411 WP_000093349.1.20447 WP_000093349.1.20473 WP_000093349.1.20479 WP_000093349.1.20487 WP_000093349.1.20554 WP_000093349.1.20558 WP_000093349.1.20574 WP_000093349.1.20579 WP_000093349.1.20585 WP_000093349.1.20611 WP_000093349.1.20619 WP_000093349.1.20620 WP_000093349.1.20661 WP_000093349.1.20736 WP_000093349.1.20772 WP_000093349.1.20796 WP_000093349.1.20821 WP_000093349.1.20833 WP_000093349.1.20838 WP_000093349.1.20846 WP_000093349.1.20860 WP_000093349.1.20867 WP_000093349.1.20878 WP_000093349.1.20913 WP_000093349.1.20922 WP_000093349.1.20935 WP_000093349.1.20939 WP_000093349.1.20945 WP_000093349.1.20971 WP_000093349.1.20975 WP_000093349.1.20979 WP_000093349.1.21009 WP_000093349.1.21013 WP_000093349.1.21054 WP_000093349.1.21056 WP_000093349.1.21064 WP_000093349.1.21066 WP_000093349.1.21078 WP_000093349.1.21080 WP_000093349.1.21102 WP_000093349.1.21109 WP_000093349.1.21111 WP_000093349.1.21154 WP_000093349.1.21183 WP_000093349.1.2119 WP_000093349.1.21257 WP_000093349.1.21272 WP_000093349.1.2128 WP_000093349.1.21312 WP_000093349.1.21313 WP_000093349.1.21330 WP_000093349.1.21339 WP_000093349.1.2135 WP_000093349.1.21356 WP_000093349.1.21359 WP_000093349.1.21375 WP_000093349.1.21379 WP_000093349.1.21386 WP_000093349.1.21393 WP_000093349.1.21402 WP_000093349.1.21412 WP_000093349.1.21449 WP_000093349.1.21458 WP_000093349.1.21464 WP_000093349.1.21465 WP_000093349.1.21480 WP_000093349.1.21500 WP_000093349.1.21511 WP_000093349.1.21514 WP_000093349.1.21572 WP_000093349.1.21583 WP_000093349.1.2159 WP_000093349.1.21601 WP_000093349.1.21636 WP_000093349.1.21679 WP_000093349.1.21712 WP_000093349.1.21724 WP_000093349.1.21746 WP_000093349.1.21763 WP_000093349.1.2178 WP_000093349.1.21787 WP_000093349.1.21820 WP_000093349.1.21830 WP_000093349.1.21890 WP_000093349.1.21894 WP_000093349.1.21901 WP_000093349.1.21954 WP_000093349.1.21988 WP_000093349.1.22022 WP_000093349.1.22027 WP_000093349.1.22045 WP_000093349.1.22065 WP_000093349.1.22082 WP_000093349.1.22093 WP_000093349.1.2211 WP_000093349.1.22111 WP_000093349.1.22163 WP_000093349.1.22165 WP_000093349.1.22170 WP_000093349.1.22174 WP_000093349.1.22177 WP_000093349.1.22180 WP_000093349.1.22197 WP_000093349.1.22200 WP_000093349.1.22227 WP_000093349.1.22246 WP_000093349.1.22259 WP_000093349.1.22302 WP_000093349.1.22344 WP_000093349.1.22367 WP_000093349.1.22369 WP_000093349.1.22400 WP_000093349.1.22418 WP_000093349.1.22493 WP_000093349.1.22526 WP_000093349.1.22531 WP_000093349.1.22533 WP_000093349.1.22547 WP_000093349.1.22551 WP_000093349.1.22559 WP_000093349.1.22650 WP_000093349.1.22657 WP_000093349.1.22696 WP_000093349.1.22702 WP_000093349.1.22709 WP_000093349.1.22727 WP_000093349.1.22730 WP_000093349.1.22731 WP_000093349.1.22738 WP_000093349.1.22739 WP_000093349.1.22789 WP_000093349.1.22792 WP_000093349.1.2280 WP_000093349.1.22803 WP_000093349.1.22811 WP_000093349.1.22843 WP_000093349.1.22853 WP_000093349.1.22859 WP_000093349.1.22861 WP_000093349.1.22869 WP_000093349.1.22890 WP_000093349.1.22924 WP_000093349.1.22969 WP_000093349.1.22975 WP_000093349.1.22994 WP_000093349.1.23004 WP_000093349.1.23008 WP_000093349.1.23048 WP_000093349.1.23061 WP_000093349.1.23069 WP_000093349.1.23082 WP_000093349.1.23103 WP_000093349.1.23121 WP_000093349.1.23130 WP_000093349.1.23132 WP_000093349.1.23133 WP_000093349.1.23152 WP_000093349.1.23161 WP_000093349.1.23185 WP_000093349.1.23197 WP_000093349.1.23217 WP_000093349.1.23222 WP_000093349.1.23228 WP_000093349.1.23238 WP_000093349.1.23244 WP_000093349.1.23275 WP_000093349.1.23288 WP_000093349.1.23381 WP_000093349.1.23413 WP_000093349.1.23420 WP_000093349.1.23439 WP_000093349.1.23449 WP_000093349.1.23450 WP_000093349.1.23491 WP_000093349.1.23516 WP_000093349.1.23531 WP_000093349.1.23541 WP_000093349.1.23544 WP_000093349.1.23568 WP_000093349.1.23572 WP_000093349.1.23586 WP_000093349.1.23613 WP_000093349.1.23626 WP_000093349.1.23630 WP_000093349.1.23644 WP_000093349.1.23690 WP_000093349.1.23740 WP_000093349.1.23796 WP_000093349.1.23809 WP_000093349.1.2382 WP_000093349.1.23822 WP_000093349.1.23842 WP_000093349.1.23849 WP_000093349.1.23856 WP_000093349.1.2389 WP_000093349.1.23896 WP_000093349.1.23900 WP_000093349.1.23907 WP_000093349.1.23935 WP_000093349.1.23956 WP_000093349.1.23972 WP_000093349.1.23995 WP_000093349.1.23998 WP_000093349.1.24000 WP_000093349.1.24129 WP_000093349.1.24148 WP_000093349.1.24167 WP_000093349.1.24174 WP_000093349.1.2420 WP_000093349.1.24207 WP_000093349.1.24213 WP_000093349.1.2423 WP_000093349.1.24241 WP_000093349.1.24263 WP_000093349.1.2427 WP_000093349.1.24275 WP_000093349.1.24277 WP_000093349.1.24343 WP_000093349.1.24364 WP_000093349.1.24416 WP_000093349.1.24418 WP_000093349.1.2442 WP_000093349.1.24436 WP_000093349.1.24437 WP_000093349.1.24439 WP_000093349.1.24443 WP_000093349.1.24469 WP_000093349.1.24478 WP_000093349.1.2450 WP_000093349.1.24503 WP_000093349.1.24519 WP_000093349.1.2458 WP_000093349.1.24589 WP_000093349.1.24596 WP_000093349.1.24602 WP_000093349.1.24617 WP_000093349.1.24631 WP_000093349.1.24679 WP_000093349.1.24684 WP_000093349.1.24685 WP_000093349.1.24745 WP_000093349.1.24781 WP_000093349.1.2480 WP_000093349.1.24802 WP_000093349.1.24823 WP_000093349.1.24855 WP_000093349.1.24891 WP_000093349.1.24903 WP_000093349.1.2497 WP_000093349.1.25007 WP_000093349.1.2501 WP_000093349.1.25012 WP_000093349.1.25029 WP_000093349.1.2506 WP_000093349.1.25083 WP_000093349.1.25092 WP_000093349.1.25098 WP_000093349.1.25115 WP_000093349.1.25120 WP_000093349.1.25145 WP_000093349.1.25167 WP_000093349.1.25170 WP_000093349.1.25209 WP_000093349.1.2522 WP_000093349.1.25262 WP_000093349.1.25287 WP_000093349.1.25361 WP_000093349.1.25433 WP_000093349.1.25438 WP_000093349.1.25459 WP_000093349.1.25469 WP_000093349.1.25479 WP_000093349.1.25489 WP_000093349.1.25511 WP_000093349.1.2552 WP_000093349.1.25557 WP_000093349.1.25567 WP_000093349.1.25593 WP_000093349.1.25595 WP_000093349.1.25621 WP_000093349.1.25623 WP_000093349.1.25634 WP_000093349.1.257 WP_000093349.1.25721 WP_000093349.1.25737 WP_000093349.1.25758 WP_000093349.1.25770 WP_000093349.1.25772 WP_000093349.1.25776 WP_000093349.1.25779 WP_000093349.1.2579 WP_000093349.1.25802 WP_000093349.1.25820 WP_000093349.1.25840 WP_000093349.1.25852 WP_000093349.1.25856 WP_000093349.1.25857 WP_000093349.1.25868 WP_000093349.1.25881 WP_000093349.1.25891 WP_000093349.1.2590 WP_000093349.1.25910 WP_000093349.1.2592 WP_000093349.1.25924 WP_000093349.1.2593 WP_000093349.1.25930 WP_000093349.1.25955 WP_000093349.1.25984 WP_000093349.1.26006 WP_000093349.1.26015 WP_000093349.1.26033 WP_000093349.1.26039 WP_000093349.1.2608 WP_000093349.1.26086 WP_000093349.1.26106 WP_000093349.1.26169 WP_000093349.1.26172 WP_000093349.1.2619 WP_000093349.1.262 WP_000093349.1.2621 WP_000093349.1.26226 WP_000093349.1.26255 WP_000093349.1.26266 WP_000093349.1.26276 WP_000093349.1.26289 WP_000093349.1.26290 WP_000093349.1.26293 WP_000093349.1.26298 WP_000093349.1.26307 WP_000093349.1.26314 WP_000093349.1.26318 WP_000093349.1.2633 WP_000093349.1.26340 WP_000093349.1.26345 WP_000093349.1.26354 WP_000093349.1.26359 WP_000093349.1.26370 WP_000093349.1.26397 WP_000093349.1.26399 WP_000093349.1.26404 WP_000093349.1.26405 WP_000093349.1.2643 WP_000093349.1.2645 WP_000093349.1.26481 WP_000093349.1.26506 WP_000093349.1.2656 WP_000093349.1.2658 WP_000093349.1.26584 WP_000093349.1.2661 WP_000093349.1.26626 WP_000093349.1.2664 WP_000093349.1.26662 WP_000093349.1.26663 WP_000093349.1.26677 WP_000093349.1.26692 WP_000093349.1.26726 WP_000093349.1.2673 WP_000093349.1.26733 WP_000093349.1.26749 WP_000093349.1.26751 WP_000093349.1.26771 WP_000093349.1.26772 WP_000093349.1.26790 WP_000093349.1.26804 WP_000093349.1.2684 WP_000093349.1.26840 WP_000093349.1.26850 WP_000093349.1.26865 WP_000093349.1.2687 WP_000093349.1.26884 WP_000093349.1.2689 WP_000093349.1.26903 WP_000093349.1.26905 WP_000093349.1.26927 WP_000093349.1.26929 WP_000093349.1.26938 WP_000093349.1.26944 WP_000093349.1.26958 WP_000093349.1.26963 WP_000093349.1.2697 WP_000093349.1.27013 WP_000093349.1.27053 WP_000093349.1.27080 WP_000093349.1.27083 WP_000093349.1.27154 WP_000093349.1.27166 WP_000093349.1.27168 WP_000093349.1.27170 WP_000093349.1.27182 WP_000093349.1.2719 WP_000093349.1.27207 WP_000093349.1.27246 WP_000093349.1.2725 WP_000093349.1.27262 WP_000093349.1.27293 WP_000093349.1.27294 WP_000093349.1.27311 WP_000093349.1.27333 WP_000093349.1.2734 WP_000093349.1.27345 WP_000093349.1.27379 WP_000093349.1.27387 WP_000093349.1.27447 WP_000093349.1.27455 WP_000093349.1.27456 WP_000093349.1.27457 WP_000093349.1.27467 WP_000093349.1.2753 WP_000093349.1.27539 WP_000093349.1.27551 WP_000093349.1.27562 WP_000093349.1.2759 WP_000093349.1.27590 WP_000093349.1.27608 WP_000093349.1.27614 WP_000093349.1.27615 WP_000093349.1.27621 WP_000093349.1.27628 WP_000093349.1.27640 WP_000093349.1.27646 WP_000093349.1.27654 WP_000093349.1.27670 WP_000093349.1.27689 WP_000093349.1.27696 WP_000093349.1.27739 WP_000093349.1.27744 WP_000093349.1.27748 WP_000093349.1.27765 WP_000093349.1.27793 WP_000093349.1.27799 WP_000093349.1.27817 WP_000093349.1.27830 WP_000093349.1.27834 WP_000093349.1.27854 WP_000093349.1.27929 WP_000093349.1.2795 WP_000093349.1.27950 WP_000093349.1.27953 WP_000093349.1.27972 WP_000093349.1.28007 WP_000093349.1.28016 WP_000093349.1.28063 WP_000093349.1.28071 WP_000093349.1.28079 WP_000093349.1.28088 WP_000093349.1.28091 WP_000093349.1.28105 WP_000093349.1.28117 WP_000093349.1.28138 WP_000093349.1.28147 WP_000093349.1.28158 WP_000093349.1.28173 WP_000093349.1.28191 WP_000093349.1.28207 WP_000093349.1.28213 WP_000093349.1.28226 WP_000093349.1.28230 WP_000093349.1.28253 WP_000093349.1.28257 WP_000093349.1.28274 WP_000093349.1.28315 WP_000093349.1.28319 WP_000093349.1.28334 WP_000093349.1.28347 WP_000093349.1.28358 WP_000093349.1.28376 WP_000093349.1.28381 WP_000093349.1.28399 WP_000093349.1.28400 WP_000093349.1.28430 WP_000093349.1.28447 WP_000093349.1.28482 WP_000093349.1.28498 WP_000093349.1.28502 WP_000093349.1.2852 WP_000093349.1.28527 WP_000093349.1.28532 WP_000093349.1.28564 WP_000093349.1.28578 WP_000093349.1.28580 WP_000093349.1.28584 WP_000093349.1.28605 WP_000093349.1.28614 WP_000093349.1.2862 WP_000093349.1.28629 WP_000093349.1.28650 WP_000093349.1.28652 WP_000093349.1.28675 WP_000093349.1.28710 WP_000093349.1.28720 WP_000093349.1.28763 WP_000093349.1.28784 WP_000093349.1.28785 WP_000093349.1.28848 WP_000093349.1.28862 WP_000093349.1.28866 WP_000093349.1.28871 WP_000093349.1.28887 WP_000093349.1.28909 WP_000093349.1.2891 WP_000093349.1.28915 WP_000093349.1.28925 WP_000093349.1.28933 WP_000093349.1.28960 WP_000093349.1.28970 WP_000093349.1.28981 WP_000093349.1.28987 WP_000093349.1.29052 WP_000093349.1.29090 WP_000093349.1.29107 WP_000093349.1.29112 WP_000093349.1.2913 WP_000093349.1.29155 WP_000093349.1.29166 WP_000093349.1.29187 WP_000093349.1.29188 WP_000093349.1.29207 WP_000093349.1.29226 WP_000093349.1.29242 WP_000093349.1.29243 WP_000093349.1.29244 WP_000093349.1.29263 WP_000093349.1.29272 WP_000093349.1.29276 WP_000093349.1.29282 WP_000093349.1.29285 WP_000093349.1.29301 WP_000093349.1.29312 WP_000093349.1.29315 WP_000093349.1.29329 WP_000093349.1.29366 WP_000093349.1.29368 WP_000093349.1.29372 WP_000093349.1.29373 WP_000093349.1.29381 WP_000093349.1.29395 WP_000093349.1.29420 WP_000093349.1.29468 WP_000093349.1.29511 WP_000093349.1.29522 WP_000093349.1.29541 WP_000093349.1.29553 WP_000093349.1.29554 WP_000093349.1.29561 WP_000093349.1.2957 WP_000093349.1.29596 WP_000093349.1.29644 WP_000093349.1.29676 WP_000093349.1.29716 WP_000093349.1.2972 WP_000093349.1.29731 WP_000093349.1.29736 WP_000093349.1.2975 WP_000093349.1.29758 WP_000093349.1.29781 WP_000093349.1.29788 WP_000093349.1.29805 WP_000093349.1.2981 WP_000093349.1.2983 WP_000093349.1.29862 WP_000093349.1.29885 WP_000093349.1.29902 WP_000093349.1.29905 WP_000093349.1.29963 WP_000093349.1.2997 WP_000093349.1.29981 WP_000093349.1.29982 WP_000093349.1.30012 WP_000093349.1.30023 WP_000093349.1.30033 WP_000093349.1.30047 WP_000093349.1.30051 WP_000093349.1.30057 WP_000093349.1.30089 WP_000093349.1.30095 WP_000093349.1.30100 WP_000093349.1.30115 WP_000093349.1.30130 WP_000093349.1.30152 WP_000093349.1.30176 WP_000093349.1.30186 WP_000093349.1.30191 WP_000093349.1.30197 WP_000093349.1.30204 WP_000093349.1.30209 WP_000093349.1.30249 WP_000093349.1.30268 WP_000093349.1.30274 WP_000093349.1.30302 WP_000093349.1.30307 WP_000093349.1.30328 WP_000093349.1.30333 WP_000093349.1.30350 WP_000093349.1.30364 WP_000093349.1.30367 WP_000093349.1.30376 WP_000093349.1.30381 WP_000093349.1.30385 WP_000093349.1.30418 WP_000093349.1.30422 WP_000093349.1.30477 WP_000093349.1.30496 WP_000093349.1.30508 WP_000093349.1.30530 WP_000093349.1.30531 WP_000093349.1.30560 WP_000093349.1.30566 WP_000093349.1.30568 WP_000093349.1.30622 WP_000093349.1.30623 WP_000093349.1.30645 WP_000093349.1.30646 WP_000093349.1.30648 WP_000093349.1.30650 WP_000093349.1.30652 WP_000093349.1.30666 WP_000093349.1.30702 WP_000093349.1.30720 WP_000093349.1.30726 WP_000093349.1.30758 WP_000093349.1.30763 WP_000093349.1.3077 WP_000093349.1.30845 WP_000093349.1.30847 WP_000093349.1.30854 WP_000093349.1.30862 WP_000093349.1.30863 WP_000093349.1.30874 WP_000093349.1.30878 WP_000093349.1.30880 WP_000093349.1.30889 WP_000093349.1.30907 WP_000093349.1.30916 WP_000093349.1.30928 WP_000093349.1.30962 WP_000093349.1.3097 WP_000093349.1.30970 WP_000093349.1.30971 WP_000093349.1.30998 WP_000093349.1.31005 WP_000093349.1.31022 WP_000093349.1.31037 WP_000093349.1.31039 WP_000093349.1.31041 WP_000093349.1.31048 WP_000093349.1.31065 WP_000093349.1.31068 WP_000093349.1.31077 WP_000093349.1.31091 WP_000093349.1.31113 WP_000093349.1.31124 WP_000093349.1.31176 WP_000093349.1.31194 WP_000093349.1.31206 WP_000093349.1.31232 WP_000093349.1.31278 WP_000093349.1.31315 WP_000093349.1.31337 WP_000093349.1.31339 WP_000093349.1.31355 WP_000093349.1.31376 WP_000093349.1.31426 WP_000093349.1.31436 WP_000093349.1.31437 WP_000093349.1.31441 WP_000093349.1.31442 WP_000093349.1.31462 WP_000093349.1.31468 WP_000093349.1.31478 WP_000093349.1.31479 WP_000093349.1.315 WP_000093349.1.31505 WP_000093349.1.31529 WP_000093349.1.31539 WP_000093349.1.31567 WP_000093349.1.31568 WP_000093349.1.31605 WP_000093349.1.31611 WP_000093349.1.31638 WP_000093349.1.31642 WP_000093349.1.31647 WP_000093349.1.31653 WP_000093349.1.31667 WP_000093349.1.31686 WP_000093349.1.31701 WP_000093349.1.31743 WP_000093349.1.31753 WP_000093349.1.31787 WP_000093349.1.31797 WP_000093349.1.31817 WP_000093349.1.31827 WP_000093349.1.31828 WP_000093349.1.31842 WP_000093349.1.3188 WP_000093349.1.31892 WP_000093349.1.31925 WP_000093349.1.31931 WP_000093349.1.31949 WP_000093349.1.31994 WP_000093349.1.31997 WP_000093349.1.32003 WP_000093349.1.32005 WP_000093349.1.32029 WP_000093349.1.32059 WP_000093349.1.32067 WP_000093349.1.32077 WP_000093349.1.32118 WP_000093349.1.32122 WP_000093349.1.32125 WP_000093349.1.32160 WP_000093349.1.32167 WP_000093349.1.32207 WP_000093349.1.32217 WP_000093349.1.32244 WP_000093349.1.32248 WP_000093349.1.32281 WP_000093349.1.3229 WP_000093349.1.32295 WP_000093349.1.3231 WP_000093349.1.32339 WP_000093349.1.32365 WP_000093349.1.32384 WP_000093349.1.32405 WP_000093349.1.3242 WP_000093349.1.3244 WP_000093349.1.32464 WP_000093349.1.32474 WP_000093349.1.32481 WP_000093349.1.32483 WP_000093349.1.32514 WP_000093349.1.32534 WP_000093349.1.32565 WP_000093349.1.32584 WP_000093349.1.32599 WP_000093349.1.32607 WP_000093349.1.32634 WP_000093349.1.32645 WP_000093349.1.32739 WP_000093349.1.32746 WP_000093349.1.32761 WP_000093349.1.32763 WP_000093349.1.32764 WP_000093349.1.32770 WP_000093349.1.32800 WP_000093349.1.32829 WP_000093349.1.32839 WP_000093349.1.32921 WP_000093349.1.32928 WP_000093349.1.32954 WP_000093349.1.32987 WP_000093349.1.3299 WP_000093349.1.33029 WP_000093349.1.33038 WP_000093349.1.33048 WP_000093349.1.3306 WP_000093349.1.33067 WP_000093349.1.33108 WP_000093349.1.33110 WP_000093349.1.33123 WP_000093349.1.33138 WP_000093349.1.33147 WP_000093349.1.3316 WP_000093349.1.33212 WP_000093349.1.33213 WP_000093349.1.33250 WP_000093349.1.33252 WP_000093349.1.33255 WP_000093349.1.33266 WP_000093349.1.33292 WP_000093349.1.33296 WP_000093349.1.3330 WP_000093349.1.33307 WP_000093349.1.33322 WP_000093349.1.33328 WP_000093349.1.33335 WP_000093349.1.3335 WP_000093349.1.33350 WP_000093349.1.3338 WP_000093349.1.33388 WP_000093349.1.33416 WP_000093349.1.3343 WP_000093349.1.33432 WP_000093349.1.3345 WP_000093349.1.33463 WP_000093349.1.33468 WP_000093349.1.3347 WP_000093349.1.33483 WP_000093349.1.33484 WP_000093349.1.33507 WP_000093349.1.33520 WP_000093349.1.33538 WP_000093349.1.33567 WP_000093349.1.33575 WP_000093349.1.33594 WP_000093349.1.33607 WP_000093349.1.33626 WP_000093349.1.33627 WP_000093349.1.3363 WP_000093349.1.33640 WP_000093349.1.33650 WP_000093349.1.33654 WP_000093349.1.33655 WP_000093349.1.33692 WP_000093349.1.33695 WP_000093349.1.33707 WP_000093349.1.33718 WP_000093349.1.33724 WP_000093349.1.33735 WP_000093349.1.33743 WP_000093349.1.33756 WP_000093349.1.33765 WP_000093349.1.33766 WP_000093349.1.33767 WP_000093349.1.33769 WP_000093349.1.33778 WP_000093349.1.33792 WP_000093349.1.33804 WP_000093349.1.33813 WP_000093349.1.33850 WP_000093349.1.33899 WP_000093349.1.33940 WP_000093349.1.33949 WP_000093349.1.33963 WP_000093349.1.33968 WP_000093349.1.33971 WP_000093349.1.33983 WP_000093349.1.33989 WP_000093349.1.33994 WP_000093349.1.34026 WP_000093349.1.34030 WP_000093349.1.34051 WP_000093349.1.34060 WP_000093349.1.34062 WP_000093349.1.34069 WP_000093349.1.34078 WP_000093349.1.34100 WP_000093349.1.34105 WP_000093349.1.34112 WP_000093349.1.34128 WP_000093349.1.34132 WP_000093349.1.3418 WP_000093349.1.34182 WP_000093349.1.34194 WP_000093349.1.34209 WP_000093349.1.34244 WP_000093349.1.34250 WP_000093349.1.34251 WP_000093349.1.34254 WP_000093349.1.34285 WP_000093349.1.34334 WP_000093349.1.34361 WP_000093349.1.34381 WP_000093349.1.34403 WP_000093349.1.34410 WP_000093349.1.3442 WP_000093349.1.34427 WP_000093349.1.34436 WP_000093349.1.34471 WP_000093349.1.34473 WP_000093349.1.3448 WP_000093349.1.34492 WP_000093349.1.34502 WP_000093349.1.34510 WP_000093349.1.34512 WP_000093349.1.34526 WP_000093349.1.34569 WP_000093349.1.3461 WP_000093349.1.34620 WP_000093349.1.34677 WP_000093349.1.34716 WP_000093349.1.34723 WP_000093349.1.34737 WP_000093349.1.3474 WP_000093349.1.34741 WP_000093349.1.34767 WP_000093349.1.34774 WP_000093349.1.34818 WP_000093349.1.34865 WP_000093349.1.34890 WP_000093349.1.34912 WP_000093349.1.34923 WP_000093349.1.34926 WP_000093349.1.34943 WP_000093349.1.34967 WP_000093349.1.34998 WP_000093349.1.35014 WP_000093349.1.35031 WP_000093349.1.35032 WP_000093349.1.35054 WP_000093349.1.35059 WP_000093349.1.35062 WP_000093349.1.35089 WP_000093349.1.35097 WP_000093349.1.35110 WP_000093349.1.35121 WP_000093349.1.35182 WP_000093349.1.35194 WP_000093349.1.35233 WP_000093349.1.35276 WP_000093349.1.35285 WP_000093349.1.35297 WP_000093349.1.35307 WP_000093349.1.35314 WP_000093349.1.35334 WP_000093349.1.35340 WP_000093349.1.35342 WP_000093349.1.35391 WP_000093349.1.354 WP_000093349.1.35413 WP_000093349.1.35415 WP_000093349.1.35423 WP_000093349.1.3547 WP_000093349.1.3549 WP_000093349.1.35498 WP_000093349.1.35506 WP_000093349.1.35508 WP_000093349.1.35517 WP_000093349.1.35525 WP_000093349.1.35549 WP_000093349.1.35580 WP_000093349.1.35615 WP_000093349.1.35623 WP_000093349.1.35642 WP_000093349.1.35661 WP_000093349.1.35673 WP_000093349.1.35686 WP_000093349.1.3569 WP_000093349.1.35696 WP_000093349.1.35730 WP_000093349.1.3574 WP_000093349.1.35742 WP_000093349.1.35784 WP_000093349.1.3579 WP_000093349.1.35801 WP_000093349.1.35826 WP_000093349.1.35890 WP_000093349.1.35900 WP_000093349.1.35903 WP_000093349.1.35928 WP_000093349.1.35950 WP_000093349.1.35958 WP_000093349.1.36004 WP_000093349.1.36041 WP_000093349.1.36082 WP_000093349.1.36093 WP_000093349.1.36102 WP_000093349.1.3611 WP_000093349.1.36119 WP_000093349.1.36141 WP_000093349.1.3617 WP_000093349.1.36176 WP_000093349.1.36179 WP_000093349.1.36187 WP_000093349.1.36188 WP_000093349.1.36208 WP_000093349.1.36249 WP_000093349.1.36250 WP_000093349.1.36264 WP_000093349.1.36278 WP_000093349.1.36282 WP_000093349.1.36302 WP_000093349.1.36307 WP_000093349.1.36344 WP_000093349.1.36389 WP_000093349.1.36434 WP_000093349.1.36439 WP_000093349.1.36532 WP_000093349.1.36535 WP_000093349.1.3655 WP_000093349.1.36570 WP_000093349.1.36580 WP_000093349.1.36600 WP_000093349.1.36615 WP_000093349.1.36640 WP_000093349.1.36646 WP_000093349.1.3666 WP_000093349.1.36689 WP_000093349.1.36697 WP_000093349.1.36698 WP_000093349.1.36704 WP_000093349.1.36729 WP_000093349.1.36745 WP_000093349.1.3675 WP_000093349.1.36754 WP_000093349.1.36773 WP_000093349.1.36783 WP_000093349.1.36796 WP_000093349.1.36797 WP_000093349.1.36822 WP_000093349.1.36847 WP_000093349.1.3685 WP_000093349.1.36858 WP_000093349.1.3687 WP_000093349.1.36888 WP_000093349.1.3690 WP_000093349.1.36903 WP_000093349.1.36911 WP_000093349.1.36916 WP_000093349.1.36932 WP_000093349.1.36955 WP_000093349.1.36962 WP_000093349.1.36979 WP_000093349.1.36980 WP_000093349.1.36983 WP_000093349.1.36997 WP_000093349.1.37002 WP_000093349.1.37016 WP_000093349.1.3703 WP_000093349.1.37044 WP_000093349.1.37045 WP_000093349.1.37055 WP_000093349.1.37080 WP_000093349.1.3709 WP_000093349.1.37091 WP_000093349.1.37120 WP_000093349.1.37121 WP_000093349.1.37130 WP_000093349.1.37134 WP_000093349.1.37145 WP_000093349.1.37159 WP_000093349.1.3718 WP_000093349.1.3719 WP_000093349.1.3722 WP_000093349.1.37220 WP_000093349.1.37240 WP_000093349.1.37335 WP_000093349.1.37341 WP_000093349.1.37378 WP_000093349.1.37398 WP_000093349.1.37408 WP_000093349.1.37411 WP_000093349.1.37424 WP_000093349.1.37435 WP_000093349.1.37453 WP_000093349.1.37467 WP_000093349.1.37583 WP_000093349.1.37602 WP_000093349.1.37605 WP_000093349.1.37606 WP_000093349.1.37621 WP_000093349.1.37624 WP_000093349.1.37644 WP_000093349.1.37669 WP_000093349.1.37679 WP_000093349.1.3774 WP_000093349.1.37749 WP_000093349.1.3776 WP_000093349.1.37764 WP_000093349.1.37771 WP_000093349.1.37781 WP_000093349.1.37788 WP_000093349.1.37815 WP_000093349.1.37828 WP_000093349.1.37851 WP_000093349.1.37855 WP_000093349.1.37866 WP_000093349.1.37875 WP_000093349.1.37891 WP_000093349.1.37906 WP_000093349.1.37907 WP_000093349.1.37929 WP_000093349.1.37953 WP_000093349.1.37987 WP_000093349.1.38020 WP_000093349.1.38030 WP_000093349.1.38034 WP_000093349.1.38038 WP_000093349.1.38057 WP_000093349.1.38070 WP_000093349.1.38082 WP_000093349.1.38111 WP_000093349.1.38128 WP_000093349.1.3813 WP_000093349.1.38136 WP_000093349.1.38160 WP_000093349.1.3817 WP_000093349.1.38177 WP_000093349.1.3820 WP_000093349.1.38212 WP_000093349.1.38222 WP_000093349.1.38230 WP_000093349.1.38232 WP_000093349.1.38276 WP_000093349.1.38282 WP_000093349.1.38304 WP_000093349.1.38309 WP_000093349.1.38383 WP_000093349.1.38390 WP_000093349.1.3842 WP_000093349.1.38435 WP_000093349.1.38437 WP_000093349.1.38453 WP_000093349.1.38493 WP_000093349.1.38516 WP_000093349.1.3852 WP_000093349.1.38522 WP_000093349.1.38546 WP_000093349.1.38555 WP_000093349.1.38557 WP_000093349.1.38607 WP_000093349.1.38612 WP_000093349.1.38637 WP_000093349.1.38658 WP_000093349.1.3867 WP_000093349.1.38674 WP_000093349.1.38688 WP_000093349.1.38721 WP_000093349.1.3875 WP_000093349.1.38760 WP_000093349.1.38786 WP_000093349.1.38841 WP_000093349.1.38858 WP_000093349.1.38862 WP_000093349.1.38875 WP_000093349.1.38885 WP_000093349.1.38890 WP_000093349.1.38926 WP_000093349.1.38927 WP_000093349.1.38931 WP_000093349.1.38940 WP_000093349.1.38941 WP_000093349.1.38943 WP_000093349.1.38960 WP_000093349.1.38972 WP_000093349.1.38979 WP_000093349.1.38985 WP_000093349.1.38989 WP_000093349.1.390 WP_000093349.1.39012 WP_000093349.1.39014 WP_000093349.1.39017 WP_000093349.1.39026 WP_000093349.1.39043 WP_000093349.1.39053 WP_000093349.1.3906 WP_000093349.1.3908 WP_000093349.1.391 WP_000093349.1.39108 WP_000093349.1.39126 WP_000093349.1.39166 WP_000093349.1.39173 WP_000093349.1.39203 WP_000093349.1.39206 WP_000093349.1.39217 WP_000093349.1.39241 WP_000093349.1.3926 WP_000093349.1.39272 WP_000093349.1.39285 WP_000093349.1.39290 WP_000093349.1.39324 WP_000093349.1.39332 WP_000093349.1.39333 WP_000093349.1.39361 WP_000093349.1.39378 WP_000093349.1.39397 WP_000093349.1.39406 WP_000093349.1.39432 WP_000093349.1.39486 WP_000093349.1.39499 WP_000093349.1.39506 WP_000093349.1.39519 WP_000093349.1.39542 WP_000093349.1.39550 WP_000093349.1.39613 WP_000093349.1.39645 WP_000093349.1.39670 WP_000093349.1.39671 WP_000093349.1.39682 WP_000093349.1.39687 WP_000093349.1.39689 WP_000093349.1.39693 WP_000093349.1.39697 WP_000093349.1.39711 WP_000093349.1.39738 WP_000093349.1.39767 WP_000093349.1.39789 WP_000093349.1.39832 WP_000093349.1.39838 WP_000093349.1.39856 WP_000093349.1.39857 WP_000093349.1.39869 WP_000093349.1.39943 WP_000093349.1.39995 WP_000093349.1.40014 WP_000093349.1.40043 WP_000093349.1.40076 WP_000093349.1.40099 WP_000093349.1.4010 WP_000093349.1.40120 WP_000093349.1.40137 WP_000093349.1.40149 WP_000093349.1.4015 WP_000093349.1.40161 WP_000093349.1.40164 WP_000093349.1.40173 WP_000093349.1.4019 WP_000093349.1.40247 WP_000093349.1.40318 WP_000093349.1.40320 WP_000093349.1.40329 WP_000093349.1.40330 WP_000093349.1.40342 WP_000093349.1.40368 WP_000093349.1.40369 WP_000093349.1.40383 WP_000093349.1.40401 WP_000093349.1.40406 WP_000093349.1.40428 WP_000093349.1.4045 WP_000093349.1.40474 WP_000093349.1.40481 WP_000093349.1.40500 WP_000093349.1.40505 WP_000093349.1.40531 WP_000093349.1.40532 WP_000093349.1.40554 WP_000093349.1.4056 WP_000093349.1.4057 WP_000093349.1.40579 WP_000093349.1.40588 WP_000093349.1.40613 WP_000093349.1.40620 WP_000093349.1.40644 WP_000093349.1.40655 WP_000093349.1.40658 WP_000093349.1.40659 WP_000093349.1.40670 WP_000093349.1.40700 WP_000093349.1.40719 WP_000093349.1.40729 WP_000093349.1.40748 WP_000093349.1.40760 WP_000093349.1.40780 WP_000093349.1.40797 WP_000093349.1.40800 WP_000093349.1.40814 WP_000093349.1.40816 WP_000093349.1.40939 WP_000093349.1.40997 WP_000093349.1.41011 WP_000093349.1.4102 WP_000093349.1.41033 WP_000093349.1.41038 WP_000093349.1.4105 WP_000093349.1.41058 WP_000093349.1.41064 WP_000093349.1.41066 WP_000093349.1.41084 WP_000093349.1.41094 WP_000093349.1.41104 WP_000093349.1.41122 WP_000093349.1.41129 WP_000093349.1.41133 WP_000093349.1.4115 WP_000093349.1.41178 WP_000093349.1.41208 WP_000093349.1.41241 WP_000093349.1.41255 WP_000093349.1.41289 WP_000093349.1.4129 WP_000093349.1.41350 WP_000093349.1.41374 WP_000093349.1.41386 WP_000093349.1.41389 WP_000093349.1.41426 WP_000093349.1.41432 WP_000093349.1.41433 WP_000093349.1.4144 WP_000093349.1.41473 WP_000093349.1.41499 WP_000093349.1.41511 WP_000093349.1.41532 WP_000093349.1.41533 WP_000093349.1.41555 WP_000093349.1.41558 WP_000093349.1.41567 WP_000093349.1.41581 WP_000093349.1.41582 WP_000093349.1.41598 WP_000093349.1.41612 WP_000093349.1.41620 WP_000093349.1.41623 WP_000093349.1.41647 WP_000093349.1.41674 WP_000093349.1.41681 WP_000093349.1.4169 WP_000093349.1.41743 WP_000093349.1.41755 WP_000093349.1.41796 WP_000093349.1.41817 WP_000093349.1.4182 WP_000093349.1.41839 WP_000093349.1.41863 WP_000093349.1.4188 WP_000093349.1.41891 WP_000093349.1.41898 WP_000093349.1.41935 WP_000093349.1.41943 WP_000093349.1.41972 WP_000093349.1.420 WP_000093349.1.42001 WP_000093349.1.42003 WP_000093349.1.42015 WP_000093349.1.42017 WP_000093349.1.42028 WP_000093349.1.42056 WP_000093349.1.42064 WP_000093349.1.42072 WP_000093349.1.42085 WP_000093349.1.42087 WP_000093349.1.42125 WP_000093349.1.42137 WP_000093349.1.42169 WP_000093349.1.42178 WP_000093349.1.42198 WP_000093349.1.42241 WP_000093349.1.4225 WP_000093349.1.42269 WP_000093349.1.42286 WP_000093349.1.42298 WP_000093349.1.42305 WP_000093349.1.42325 WP_000093349.1.42355 WP_000093349.1.42403 WP_000093349.1.42436 WP_000093349.1.42459 WP_000093349.1.42460 WP_000093349.1.42481 WP_000093349.1.42510 WP_000093349.1.42551 WP_000093349.1.426 WP_000093349.1.42607 WP_000093349.1.42640 WP_000093349.1.42652 WP_000093349.1.42668 WP_000093349.1.42674 WP_000093349.1.42679 WP_000093349.1.42681 WP_000093349.1.42733 WP_000093349.1.42737 WP_000093349.1.42738 WP_000093349.1.42740 WP_000093349.1.42759 WP_000093349.1.42764 WP_000093349.1.42786 WP_000093349.1.42798 WP_000093349.1.42816 WP_000093349.1.42819 WP_000093349.1.42837 WP_000093349.1.42848 WP_000093349.1.42883 WP_000093349.1.42897 WP_000093349.1.42907 WP_000093349.1.42925 WP_000093349.1.4293 WP_000093349.1.42959 WP_000093349.1.42984 WP_000093349.1.4299 WP_000093349.1.42990 WP_000093349.1.43014 WP_000093349.1.43020 WP_000093349.1.43023 WP_000093349.1.43061 WP_000093349.1.43072 WP_000093349.1.43095 WP_000093349.1.43110 WP_000093349.1.43122 WP_000093349.1.43125 WP_000093349.1.43131 WP_000093349.1.43134 WP_000093349.1.43139 WP_000093349.1.43143 WP_000093349.1.43147 WP_000093349.1.43159 WP_000093349.1.43165 WP_000093349.1.43168 WP_000093349.1.43179 WP_000093349.1.43200 WP_000093349.1.43202 WP_000093349.1.43204 WP_000093349.1.43232 WP_000093349.1.43248 WP_000093349.1.4325 WP_000093349.1.43252 WP_000093349.1.4327 WP_000093349.1.43274 WP_000093349.1.43279 WP_000093349.1.43323 WP_000093349.1.43341 WP_000093349.1.43349 WP_000093349.1.43360 WP_000093349.1.43369 WP_000093349.1.4337 WP_000093349.1.43375 WP_000093349.1.43405 WP_000093349.1.43406 WP_000093349.1.4341 WP_000093349.1.43410 WP_000093349.1.43446 WP_000093349.1.43460 WP_000093349.1.4347 WP_000093349.1.43506 WP_000093349.1.43512 WP_000093349.1.43530 WP_000093349.1.43550 WP_000093349.1.43560 WP_000093349.1.43617 WP_000093349.1.43618 WP_000093349.1.43627 WP_000093349.1.43659 WP_000093349.1.43665 WP_000093349.1.43670 WP_000093349.1.43683 WP_000093349.1.43702 WP_000093349.1.43703 WP_000093349.1.4372 WP_000093349.1.43731 WP_000093349.1.43752 WP_000093349.1.43784 WP_000093349.1.43788 WP_000093349.1.43827 WP_000093349.1.4385 WP_000093349.1.4386 WP_000093349.1.43904 WP_000093349.1.43915 WP_000093349.1.43984 WP_000093349.1.43988 WP_000093349.1.43995 WP_000093349.1.44074 WP_000093349.1.44153 WP_000093349.1.44177 WP_000093349.1.44181 WP_000093349.1.44186 WP_000093349.1.44195 WP_000093349.1.44265 WP_000093349.1.44302 WP_000093349.1.44331 WP_000093349.1.44344 WP_000093349.1.44382 WP_000093349.1.44388 WP_000093349.1.44396 WP_000093349.1.44405 WP_000093349.1.44420 WP_000093349.1.44432 WP_000093349.1.44504 WP_000093349.1.44515 WP_000093349.1.44520 WP_000093349.1.44536 WP_000093349.1.44544 WP_000093349.1.44579 WP_000093349.1.44586 WP_000093349.1.44588 WP_000093349.1.44605 WP_000093349.1.44623 WP_000093349.1.44631 WP_000093349.1.44667 WP_000093349.1.44672 WP_000093349.1.447 WP_000093349.1.44714 WP_000093349.1.44715 WP_000093349.1.44732 WP_000093349.1.44755 WP_000093349.1.44780 WP_000093349.1.44785 WP_000093349.1.44788 WP_000093349.1.44796 WP_000093349.1.44856 WP_000093349.1.44868 WP_000093349.1.44876 WP_000093349.1.44881 WP_000093349.1.44882 WP_000093349.1.44892 WP_000093349.1.44899 WP_000093349.1.44914 WP_000093349.1.44955 WP_000093349.1.44969 WP_000093349.1.4499 WP_000093349.1.44993 WP_000093349.1.45008 WP_000093349.1.45033 WP_000093349.1.45035 WP_000093349.1.45042 WP_000093349.1.45080 WP_000093349.1.45091 WP_000093349.1.45094 WP_000093349.1.45099 WP_000093349.1.45114 WP_000093349.1.4513 WP_000093349.1.45133 WP_000093349.1.45140 WP_000093349.1.45157 WP_000093349.1.45162 WP_000093349.1.45164 WP_000093349.1.45170 WP_000093349.1.45221 WP_000093349.1.45223 WP_000093349.1.45242 WP_000093349.1.45267 WP_000093349.1.4527 WP_000093349.1.45272 WP_000093349.1.45281 WP_000093349.1.45290 WP_000093349.1.45297 WP_000093349.1.453 WP_000093349.1.45364 WP_000093349.1.45419 WP_000093349.1.45431 WP_000093349.1.45439 WP_000093349.1.45450 WP_000093349.1.45456 WP_000093349.1.4546 WP_000093349.1.45472 WP_000093349.1.4550 WP_000093349.1.45507 WP_000093349.1.45542 WP_000093349.1.45555 WP_000093349.1.45560 WP_000093349.1.45574 WP_000093349.1.45577 WP_000093349.1.45610 WP_000093349.1.45645 WP_000093349.1.45670 WP_000093349.1.45698 WP_000093349.1.45703 WP_000093349.1.45705 WP_000093349.1.45730 WP_000093349.1.45734 WP_000093349.1.45768 WP_000093349.1.4577 WP_000093349.1.45771 WP_000093349.1.45773 WP_000093349.1.45780 WP_000093349.1.4582 WP_000093349.1.4584 WP_000093349.1.45852 WP_000093349.1.45859 WP_000093349.1.45862 WP_000093349.1.45874 WP_000093349.1.45878 WP_000093349.1.45897 WP_000093349.1.45954 WP_000093349.1.4597 WP_000093349.1.45977 WP_000093349.1.45979 WP_000093349.1.4598 WP_000093349.1.46003 WP_000093349.1.46005 WP_000093349.1.46013 WP_000093349.1.46035 WP_000093349.1.46037 WP_000093349.1.46050 WP_000093349.1.46055 WP_000093349.1.46062 WP_000093349.1.46078 WP_000093349.1.46082 WP_000093349.1.46087 WP_000093349.1.46109 WP_000093349.1.46168 WP_000093349.1.46171 WP_000093349.1.46172 WP_000093349.1.46185 WP_000093349.1.46195 WP_000093349.1.46208 WP_000093349.1.46222 WP_000093349.1.46228 WP_000093349.1.46248 WP_000093349.1.46276 WP_000093349.1.46330 WP_000093349.1.46333 WP_000093349.1.46334 WP_000093349.1.46339 WP_000093349.1.46353 WP_000093349.1.46362 WP_000093349.1.46368 WP_000093349.1.46380 WP_000093349.1.46401 WP_000093349.1.46418 WP_000093349.1.46422 WP_000093349.1.46465 WP_000093349.1.46529 WP_000093349.1.46543 WP_000093349.1.46619 WP_000093349.1.4662 WP_000093349.1.46648 WP_000093349.1.46660 WP_000093349.1.46664 WP_000093349.1.46670 WP_000093349.1.46676 WP_000093349.1.46692 WP_000093349.1.46702 WP_000093349.1.46703 WP_000093349.1.46720 WP_000093349.1.46736 WP_000093349.1.46752 WP_000093349.1.46765 WP_000093349.1.46770 WP_000093349.1.4680 WP_000093349.1.46852 WP_000093349.1.46881 WP_000093349.1.46906 WP_000093349.1.46908 WP_000093349.1.46911 WP_000093349.1.46914 WP_000093349.1.46925 WP_000093349.1.46929 WP_000093349.1.46937 WP_000093349.1.4694 WP_000093349.1.46947 WP_000093349.1.46965 WP_000093349.1.46983 WP_000093349.1.46995 WP_000093349.1.47002 WP_000093349.1.47051 WP_000093349.1.47090 WP_000093349.1.47107 WP_000093349.1.47111 WP_000093349.1.47128 WP_000093349.1.47153 WP_000093349.1.47159 WP_000093349.1.47163 WP_000093349.1.47175 WP_000093349.1.47187 WP_000093349.1.47211 WP_000093349.1.47216 WP_000093349.1.47258 WP_000093349.1.47269 WP_000093349.1.47276 WP_000093349.1.47279 WP_000093349.1.4728 WP_000093349.1.47282 WP_000093349.1.47290 WP_000093349.1.47294 WP_000093349.1.47306 WP_000093349.1.47328 WP_000093349.1.47331 WP_000093349.1.47334 WP_000093349.1.47381 WP_000093349.1.47399 WP_000093349.1.47406 WP_000093349.1.47408 WP_000093349.1.47426 WP_000093349.1.47432 WP_000093349.1.47439 WP_000093349.1.47459 WP_000093349.1.47493 WP_000093349.1.47522 WP_000093349.1.47560 WP_000093349.1.47617 WP_000093349.1.47618 WP_000093349.1.47669 WP_000093349.1.4767 WP_000093349.1.47680 WP_000093349.1.477 WP_000093349.1.47719 WP_000093349.1.47733 WP_000093349.1.47747 WP_000093349.1.47763 WP_000093349.1.47782 WP_000093349.1.47835 WP_000093349.1.47851 WP_000093349.1.47859 WP_000093349.1.47872 WP_000093349.1.47873 WP_000093349.1.47904 WP_000093349.1.47908 WP_000093349.1.4792 WP_000093349.1.47989 WP_000093349.1.47996 WP_000093349.1.48011 WP_000093349.1.48030 WP_000093349.1.48046 WP_000093349.1.48047 WP_000093349.1.4805 WP_000093349.1.48057 WP_000093349.1.48067 WP_000093349.1.48116 WP_000093349.1.48142 WP_000093349.1.48149 WP_000093349.1.4815 WP_000093349.1.48154 WP_000093349.1.48156 WP_000093349.1.48169 WP_000093349.1.48186 WP_000093349.1.48187 WP_000093349.1.48205 WP_000093349.1.48223 WP_000093349.1.48227 WP_000093349.1.48236 WP_000093349.1.48250 WP_000093349.1.48272 WP_000093349.1.48282 WP_000093349.1.48284 WP_000093349.1.48293 WP_000093349.1.48307 WP_000093349.1.48310 WP_000093349.1.48322 WP_000093349.1.48335 WP_000093349.1.48376 WP_000093349.1.48391 WP_000093349.1.48394 WP_000093349.1.48398 WP_000093349.1.4840 WP_000093349.1.48425 WP_000093349.1.48427 WP_000093349.1.48437 WP_000093349.1.48438 WP_000093349.1.48463 WP_000093349.1.48479 WP_000093349.1.4852 WP_000093349.1.48563 WP_000093349.1.48577 WP_000093349.1.48580 WP_000093349.1.48593 WP_000093349.1.48634 WP_000093349.1.48655 WP_000093349.1.48656 WP_000093349.1.48670 WP_000093349.1.4868 WP_000093349.1.48705 WP_000093349.1.48711 WP_000093349.1.48723 WP_000093349.1.48769 WP_000093349.1.48775 WP_000093349.1.48782 WP_000093349.1.48805 WP_000093349.1.48817 WP_000093349.1.48818 WP_000093349.1.48823 WP_000093349.1.48833 WP_000093349.1.48835 WP_000093349.1.4886 WP_000093349.1.48869 WP_000093349.1.48936 WP_000093349.1.48941 WP_000093349.1.48945 WP_000093349.1.48966 WP_000093349.1.48968 WP_000093349.1.48982 WP_000093349.1.48993 WP_000093349.1.4901 WP_000093349.1.49018 WP_000093349.1.49032 WP_000093349.1.4905 WP_000093349.1.49071 WP_000093349.1.49094 WP_000093349.1.49105 WP_000093349.1.49128 WP_000093349.1.49129 WP_000093349.1.49154 WP_000093349.1.49159 WP_000093349.1.4916 WP_000093349.1.49161 WP_000093349.1.4917 WP_000093349.1.49171 WP_000093349.1.49173 WP_000093349.1.4918 WP_000093349.1.49189 WP_000093349.1.49196 WP_000093349.1.49199 WP_000093349.1.49207 WP_000093349.1.49234 WP_000093349.1.49248 WP_000093349.1.49257 WP_000093349.1.49301 WP_000093349.1.49326 WP_000093349.1.49327 WP_000093349.1.49398 WP_000093349.1.49418 WP_000093349.1.4945 WP_000093349.1.49479 WP_000093349.1.4950 WP_000093349.1.49518 WP_000093349.1.49539 WP_000093349.1.49549 WP_000093349.1.49581 WP_000093349.1.49582 WP_000093349.1.496 WP_000093349.1.49603 WP_000093349.1.4962 WP_000093349.1.49643 WP_000093349.1.49653 WP_000093349.1.49669 WP_000093349.1.49672 WP_000093349.1.49690 WP_000093349.1.49704 WP_000093349.1.49715 WP_000093349.1.49728 WP_000093349.1.49730 WP_000093349.1.49732 WP_000093349.1.49742 WP_000093349.1.49745 WP_000093349.1.4980 WP_000093349.1.49800 WP_000093349.1.49819 WP_000093349.1.4984 WP_000093349.1.49860 WP_000093349.1.49863 WP_000093349.1.49871 WP_000093349.1.4989 WP_000093349.1.49894 WP_000093349.1.49907 WP_000093349.1.49913 WP_000093349.1.49918 WP_000093349.1.49934 WP_000093349.1.49935 WP_000093349.1.49936 WP_000093349.1.4994 WP_000093349.1.49970 WP_000093349.1.49982 WP_000093349.1.50013 WP_000093349.1.50015 WP_000093349.1.50028 WP_000093349.1.50038 WP_000093349.1.50039 WP_000093349.1.50061 WP_000093349.1.50076 WP_000093349.1.50117 WP_000093349.1.5013 WP_000093349.1.50138 WP_000093349.1.50145 WP_000093349.1.50192 WP_000093349.1.50217 WP_000093349.1.50219 WP_000093349.1.50229 WP_000093349.1.50261 WP_000093349.1.50291 WP_000093349.1.50313 WP_000093349.1.50356 WP_000093349.1.50360 WP_000093349.1.50367 WP_000093349.1.50377 WP_000093349.1.50388 WP_000093349.1.50425 WP_000093349.1.50430 WP_000093349.1.50431 WP_000093349.1.5045 WP_000093349.1.50464 WP_000093349.1.50477 WP_000093349.1.50516 WP_000093349.1.50525 WP_000093349.1.50536 WP_000093349.1.50555 WP_000093349.1.50558 WP_000093349.1.50568 WP_000093349.1.50578 WP_000093349.1.5059 WP_000093349.1.50594 WP_000093349.1.50595 WP_000093349.1.50647 WP_000093349.1.50660 WP_000093349.1.50669 WP_000093349.1.50699 WP_000093349.1.50740 WP_000093349.1.50759 WP_000093349.1.50768 WP_000093349.1.50799 WP_000093349.1.50817 WP_000093349.1.50820 WP_000093349.1.50827 WP_000093349.1.50829 WP_000093349.1.5087 WP_000093349.1.50884 WP_000093349.1.50896 WP_000093349.1.50937 WP_000093349.1.50962 WP_000093349.1.50974 WP_000093349.1.51008 WP_000093349.1.51015 WP_000093349.1.51062 WP_000093349.1.51085 WP_000093349.1.5109 WP_000093349.1.5110 WP_000093349.1.5111 WP_000093349.1.51130 WP_000093349.1.51138 WP_000093349.1.51152 WP_000093349.1.51209 WP_000093349.1.51220 WP_000093349.1.51226 WP_000093349.1.51236 WP_000093349.1.51245 WP_000093349.1.51277 WP_000093349.1.51282 WP_000093349.1.51295 WP_000093349.1.51306 WP_000093349.1.51310 WP_000093349.1.51326 WP_000093349.1.51346 WP_000093349.1.51365 WP_000093349.1.51376 WP_000093349.1.51393 WP_000093349.1.51403 WP_000093349.1.51454 WP_000093349.1.51456 WP_000093349.1.51492 WP_000093349.1.51496 WP_000093349.1.515 WP_000093349.1.51527 WP_000093349.1.5155 WP_000093349.1.51557 WP_000093349.1.51575 WP_000093349.1.51590 WP_000093349.1.51716 WP_000093349.1.51744 WP_000093349.1.51748 WP_000093349.1.51787 WP_000093349.1.51794 WP_000093349.1.51797 WP_000093349.1.51812 WP_000093349.1.51824 WP_000093349.1.51836 WP_000093349.1.51842 WP_000093349.1.51844 WP_000093349.1.51871 WP_000093349.1.51883 WP_000093349.1.5190 WP_000093349.1.51912 WP_000093349.1.51920 WP_000093349.1.51924 WP_000093349.1.51936 WP_000093349.1.51952 WP_000093349.1.51971 WP_000093349.1.52034 WP_000093349.1.52061 WP_000093349.1.52072 WP_000093349.1.52078 WP_000093349.1.521 WP_000093349.1.5213 WP_000093349.1.52151 WP_000093349.1.52162 WP_000093349.1.52182 WP_000093349.1.52185 WP_000093349.1.52193 WP_000093349.1.52195 WP_000093349.1.52198 WP_000093349.1.52210 WP_000093349.1.52224 WP_000093349.1.52251 WP_000093349.1.52252 WP_000093349.1.52259 WP_000093349.1.52289 WP_000093349.1.52296 WP_000093349.1.523 WP_000093349.1.52308 WP_000093349.1.52322 WP_000093349.1.52327 WP_000093349.1.52331 WP_000093349.1.52340 WP_000093349.1.52343 WP_000093349.1.52377 WP_000093349.1.52396 WP_000093349.1.52427 WP_000093349.1.52440 WP_000093349.1.52442 WP_000093349.1.52452 WP_000093349.1.52463 WP_000093349.1.5251 WP_000093349.1.52511 WP_000093349.1.52518 WP_000093349.1.52536 WP_000093349.1.52548 WP_000093349.1.52595 WP_000093349.1.52605 WP_000093349.1.52623 WP_000093349.1.52624 WP_000093349.1.52633 WP_000093349.1.52645 WP_000093349.1.52670 WP_000093349.1.52687 WP_000093349.1.52699 WP_000093349.1.52715 WP_000093349.1.52722 WP_000093349.1.52772 WP_000093349.1.52820 WP_000093349.1.52830 WP_000093349.1.52838 WP_000093349.1.52848 WP_000093349.1.52865 WP_000093349.1.52877 WP_000093349.1.52878 WP_000093349.1.52889 WP_000093349.1.52900 WP_000093349.1.52904 WP_000093349.1.52941 WP_000093349.1.52947 WP_000093349.1.52965 WP_000093349.1.52983 WP_000093349.1.52984 WP_000093349.1.53002 WP_000093349.1.53007 WP_000093349.1.5304 WP_000093349.1.53050 WP_000093349.1.53057 WP_000093349.1.53071 WP_000093349.1.53077 WP_000093349.1.53140 WP_000093349.1.53153 WP_000093349.1.53178 WP_000093349.1.5319 WP_000093349.1.53209 WP_000093349.1.53245 WP_000093349.1.53260 WP_000093349.1.53312 WP_000093349.1.53317 WP_000093349.1.53319 WP_000093349.1.53323 WP_000093349.1.53363 WP_000093349.1.53373 WP_000093349.1.53379 WP_000093349.1.53387 WP_000093349.1.53394 WP_000093349.1.53403 WP_000093349.1.53408 WP_000093349.1.53418 WP_000093349.1.53432 WP_000093349.1.53433 WP_000093349.1.53452 WP_000093349.1.53462 WP_000093349.1.53467 WP_000093349.1.53521 WP_000093349.1.53577 WP_000093349.1.53641 WP_000093349.1.53648 WP_000093349.1.53661 WP_000093349.1.53671 WP_000093349.1.53682 WP_000093349.1.53691 WP_000093349.1.53712 WP_000093349.1.53714 WP_000093349.1.53759 WP_000093349.1.53763 WP_000093349.1.53766 WP_000093349.1.53774 WP_000093349.1.53786 WP_000093349.1.53799 WP_000093349.1.53827 WP_000093349.1.53835 WP_000093349.1.53889 WP_000093349.1.53911 WP_000093349.1.53915 WP_000093349.1.53926 WP_000093349.1.53934 WP_000093349.1.53999 WP_000093349.1.5401 WP_000093349.1.54022 WP_000093349.1.54049 WP_000093349.1.54074 WP_000093349.1.54086 WP_000093349.1.54109 WP_000093349.1.54135 WP_000093349.1.54147 WP_000093349.1.54229 WP_000093349.1.54237 WP_000093349.1.54253 WP_000093349.1.54269 WP_000093349.1.54297 WP_000093349.1.54299 WP_000093349.1.54395 WP_000093349.1.544 WP_000093349.1.54404 WP_000093349.1.54413 WP_000093349.1.54438 WP_000093349.1.54471 WP_000093349.1.54477 WP_000093349.1.54479 WP_000093349.1.54485 WP_000093349.1.54491 WP_000093349.1.54503 WP_000093349.1.54510 WP_000093349.1.54551 WP_000093349.1.54554 WP_000093349.1.54574 WP_000093349.1.54637 WP_000093349.1.54675 WP_000093349.1.5469 WP_000093349.1.54744 WP_000093349.1.54745 WP_000093349.1.54753 WP_000093349.1.54847 WP_000093349.1.54878 WP_000093349.1.54914 WP_000093349.1.54931 WP_000093349.1.54955 WP_000093349.1.54967 WP_000093349.1.54990 WP_000093349.1.5500 WP_000093349.1.55004 WP_000093349.1.55014 WP_000093349.1.55058 WP_000093349.1.55082 WP_000093349.1.55084 WP_000093349.1.55090 WP_000093349.1.55095 WP_000093349.1.55100 WP_000093349.1.55139 WP_000093349.1.5518 WP_000093349.1.5519 WP_000093349.1.552 WP_000093349.1.55214 WP_000093349.1.55239 WP_000093349.1.55271 WP_000093349.1.55274 WP_000093349.1.55309 WP_000093349.1.55327 WP_000093349.1.55336 WP_000093349.1.55352 WP_000093349.1.5536 WP_000093349.1.55367 WP_000093349.1.55369 WP_000093349.1.55403 WP_000093349.1.55405 WP_000093349.1.55419 WP_000093349.1.55421 WP_000093349.1.55495 WP_000093349.1.5550 WP_000093349.1.55508 WP_000093349.1.55527 WP_000093349.1.55535 WP_000093349.1.5554 WP_000093349.1.55544 WP_000093349.1.55558 WP_000093349.1.55583 WP_000093349.1.5559 WP_000093349.1.55603 WP_000093349.1.55620 WP_000093349.1.55628 WP_000093349.1.55637 WP_000093349.1.5565 WP_000093349.1.55653 WP_000093349.1.557 WP_000093349.1.55719 WP_000093349.1.55724 WP_000093349.1.55728 WP_000093349.1.5575 WP_000093349.1.55786 WP_000093349.1.5580 WP_000093349.1.55818 WP_000093349.1.55831 WP_000093349.1.55839 WP_000093349.1.55845 WP_000093349.1.55848 WP_000093349.1.55859 WP_000093349.1.55867 WP_000093349.1.55886 WP_000093349.1.5589 WP_000093349.1.55904 WP_000093349.1.55916 WP_000093349.1.55933 WP_000093349.1.55949 WP_000093349.1.55953 WP_000093349.1.55955 WP_000093349.1.56000 WP_000093349.1.56003 WP_000093349.1.56025 WP_000093349.1.5604 WP_000093349.1.56048 WP_000093349.1.56064 WP_000093349.1.56078 WP_000093349.1.56098 WP_000093349.1.56099 WP_000093349.1.56106 WP_000093349.1.56135 WP_000093349.1.56200 WP_000093349.1.56210 WP_000093349.1.56213 WP_000093349.1.56220 WP_000093349.1.56225 WP_000093349.1.5623 WP_000093349.1.56237 WP_000093349.1.56239 WP_000093349.1.56241 WP_000093349.1.56260 WP_000093349.1.56272 WP_000093349.1.56275 WP_000093349.1.56281 WP_000093349.1.56332 WP_000093349.1.56333 WP_000093349.1.5635 WP_000093349.1.56364 WP_000093349.1.5637 WP_000093349.1.56387 WP_000093349.1.56400 WP_000093349.1.5644 WP_000093349.1.56464 WP_000093349.1.56482 WP_000093349.1.56522 WP_000093349.1.56525 WP_000093349.1.56527 WP_000093349.1.56542 WP_000093349.1.56558 WP_000093349.1.5658 WP_000093349.1.56598 WP_000093349.1.566 WP_000093349.1.56608 WP_000093349.1.56619 WP_000093349.1.56628 WP_000093349.1.56641 WP_000093349.1.56658 WP_000093349.1.5666 WP_000093349.1.56679 WP_000093349.1.56702 WP_000093349.1.56708 WP_000093349.1.5675 WP_000093349.1.56767 WP_000093349.1.5677 WP_000093349.1.56778 WP_000093349.1.56794 WP_000093349.1.56815 WP_000093349.1.56822 WP_000093349.1.56856 WP_000093349.1.5686 WP_000093349.1.56865 WP_000093349.1.569 WP_000093349.1.56903 WP_000093349.1.56931 WP_000093349.1.56966 WP_000093349.1.56975 WP_000093349.1.56986 WP_000093349.1.57015 WP_000093349.1.57047 WP_000093349.1.5705 WP_000093349.1.57073 WP_000093349.1.57075 WP_000093349.1.57081 WP_000093349.1.57097 WP_000093349.1.57109 WP_000093349.1.57115 WP_000093349.1.57141 WP_000093349.1.57158 WP_000093349.1.57170 WP_000093349.1.5718 WP_000093349.1.57190 WP_000093349.1.57196 WP_000093349.1.57214 WP_000093349.1.57265 WP_000093349.1.57271 WP_000093349.1.57291 WP_000093349.1.57309 WP_000093349.1.57330 WP_000093349.1.5735 WP_000093349.1.57385 WP_000093349.1.57427 WP_000093349.1.5743 WP_000093349.1.57445 WP_000093349.1.57448 WP_000093349.1.57481 WP_000093349.1.5749 WP_000093349.1.57593 WP_000093349.1.57594 WP_000093349.1.57612 WP_000093349.1.57635 WP_000093349.1.57650 WP_000093349.1.57665 WP_000093349.1.57670 WP_000093349.1.57682 WP_000093349.1.57692 WP_000093349.1.57693 WP_000093349.1.57701 WP_000093349.1.57718 WP_000093349.1.57723 WP_000093349.1.57727 WP_000093349.1.57730 WP_000093349.1.57734 WP_000093349.1.57745 WP_000093349.1.57754 WP_000093349.1.57783 WP_000093349.1.57819 WP_000093349.1.57837 WP_000093349.1.57840 WP_000093349.1.57844 WP_000093349.1.57861 WP_000093349.1.57878 WP_000093349.1.5791 WP_000093349.1.57928 WP_000093349.1.57943 WP_000093349.1.57952 WP_000093349.1.57962 WP_000093349.1.57974 WP_000093349.1.5799 WP_000093349.1.58006 WP_000093349.1.58016 WP_000093349.1.58049 WP_000093349.1.58051 WP_000093349.1.58074 WP_000093349.1.58116 WP_000093349.1.58122 WP_000093349.1.58127 WP_000093349.1.58139 WP_000093349.1.58148 WP_000093349.1.58158 WP_000093349.1.5816 WP_000093349.1.5817 WP_000093349.1.58198 WP_000093349.1.58212 WP_000093349.1.58241 WP_000093349.1.58246 WP_000093349.1.5827 WP_000093349.1.58277 WP_000093349.1.58317 WP_000093349.1.58321 WP_000093349.1.58325 WP_000093349.1.58350 WP_000093349.1.58352 WP_000093349.1.58353 WP_000093349.1.58364 WP_000093349.1.58366 WP_000093349.1.58373 WP_000093349.1.58392 WP_000093349.1.58395 WP_000093349.1.58421 WP_000093349.1.58430 WP_000093349.1.58435 WP_000093349.1.5849 WP_000093349.1.58495 WP_000093349.1.58508 WP_000093349.1.58512 WP_000093349.1.58521 WP_000093349.1.58530 WP_000093349.1.58538 WP_000093349.1.58571 WP_000093349.1.58584 WP_000093349.1.58588 WP_000093349.1.58592 WP_000093349.1.58598 WP_000093349.1.586 WP_000093349.1.58714 WP_000093349.1.58735 WP_000093349.1.58760 WP_000093349.1.58763 WP_000093349.1.58772 WP_000093349.1.58775 WP_000093349.1.5880 WP_000093349.1.58833 WP_000093349.1.58855 WP_000093349.1.58860 WP_000093349.1.58934 WP_000093349.1.58998 WP_000093349.1.5901 WP_000093349.1.59011 WP_000093349.1.59014 WP_000093349.1.59039 WP_000093349.1.5904 WP_000093349.1.59077 WP_000093349.1.59098 WP_000093349.1.59124 WP_000093349.1.59133 WP_000093349.1.59146 WP_000093349.1.59178 WP_000093349.1.59187 WP_000093349.1.5920 WP_000093349.1.5925 WP_000093349.1.59269 WP_000093349.1.59284 WP_000093349.1.59311 WP_000093349.1.59327 WP_000093349.1.59334 WP_000093349.1.59363 WP_000093349.1.59397 WP_000093349.1.59398 WP_000093349.1.5940 WP_000093349.1.59404 WP_000093349.1.59414 WP_000093349.1.59457 WP_000093349.1.59459 WP_000093349.1.59462 WP_000093349.1.59464 WP_000093349.1.59467 WP_000093349.1.59478 WP_000093349.1.59498 WP_000093349.1.59540 WP_000093349.1.59546 WP_000093349.1.59547 WP_000093349.1.59594 WP_000093349.1.59598 WP_000093349.1.59603 WP_000093349.1.59609 WP_000093349.1.59624 WP_000093349.1.59629 WP_000093349.1.59643 WP_000093349.1.59663 WP_000093349.1.59668 WP_000093349.1.59669 WP_000093349.1.59671 WP_000093349.1.59697 WP_000093349.1.5972 WP_000093349.1.59787 WP_000093349.1.59803 WP_000093349.1.59819 WP_000093349.1.5982 WP_000093349.1.59822 WP_000093349.1.59864 WP_000093349.1.59874 WP_000093349.1.59881 WP_000093349.1.59886 WP_000093349.1.59907 WP_000093349.1.59915 WP_000093349.1.59977 WP_000093349.1.60006 WP_000093349.1.60022 WP_000093349.1.6006 WP_000093349.1.60086 WP_000093349.1.6011 WP_000093349.1.60118 WP_000093349.1.60147 WP_000093349.1.60149 WP_000093349.1.60156 WP_000093349.1.60157 WP_000093349.1.60158 WP_000093349.1.6017 WP_000093349.1.60181 WP_000093349.1.60251 WP_000093349.1.60259 WP_000093349.1.60280 WP_000093349.1.60302 WP_000093349.1.60307 WP_000093349.1.60339 WP_000093349.1.60345 WP_000093349.1.60353 WP_000093349.1.60355 WP_000093349.1.60360 WP_000093349.1.60368 WP_000093349.1.60431 WP_000093349.1.60434 WP_000093349.1.60462 WP_000093349.1.60492 WP_000093349.1.60515 WP_000093349.1.60547 WP_000093349.1.60551 WP_000093349.1.60585 WP_000093349.1.60594 WP_000093349.1.60636 WP_000093349.1.60641 WP_000093349.1.60690 WP_000093349.1.60696 WP_000093349.1.60719 WP_000093349.1.60730 WP_000093349.1.60734 WP_000093349.1.60742 WP_000093349.1.60750 WP_000093349.1.60751 WP_000093349.1.60758 WP_000093349.1.60759 WP_000093349.1.60765 WP_000093349.1.60778 WP_000093349.1.60787 WP_000093349.1.60813 WP_000093349.1.60820 WP_000093349.1.60845 WP_000093349.1.6085 WP_000093349.1.60859 WP_000093349.1.60869 WP_000093349.1.60888 WP_000093349.1.60898 WP_000093349.1.60912 WP_000093349.1.60923 WP_000093349.1.60934 WP_000093349.1.60939 WP_000093349.1.60948 WP_000093349.1.60965 WP_000093349.1.60981 WP_000093349.1.60991 WP_000093349.1.61009 WP_000093349.1.61013 WP_000093349.1.61019 WP_000093349.1.61023 WP_000093349.1.61026 WP_000093349.1.61029 WP_000093349.1.61030 WP_000093349.1.61031 WP_000093349.1.61082 WP_000093349.1.61115 WP_000093349.1.61119 WP_000093349.1.61139 WP_000093349.1.61152 WP_000093349.1.61153 WP_000093349.1.6118 WP_000093349.1.61188 WP_000093349.1.61189 WP_000093349.1.6119 WP_000093349.1.6123 WP_000093349.1.61257 WP_000093349.1.61263 WP_000093349.1.61271 WP_000093349.1.61286 WP_000093349.1.61289 WP_000093349.1.61313 WP_000093349.1.61316 WP_000093349.1.61318 WP_000093349.1.61324 WP_000093349.1.61339 WP_000093349.1.61346 WP_000093349.1.61353 WP_000093349.1.6136 WP_000093349.1.61375 WP_000093349.1.61393 WP_000093349.1.61394 WP_000093349.1.61408 WP_000093349.1.61421 WP_000093349.1.61430 WP_000093349.1.61439 WP_000093349.1.61440 WP_000093349.1.6149 WP_000093349.1.61515 WP_000093349.1.61547 WP_000093349.1.61555 WP_000093349.1.61585 WP_000093349.1.61591 WP_000093349.1.61597 WP_000093349.1.61615 WP_000093349.1.61639 WP_000093349.1.61653 WP_000093349.1.6166 WP_000093349.1.6168 WP_000093349.1.61705 WP_000093349.1.61709 WP_000093349.1.61713 WP_000093349.1.61749 WP_000093349.1.61776 WP_000093349.1.61784 WP_000093349.1.61800 WP_000093349.1.61802 WP_000093349.1.61831 WP_000093349.1.61838 WP_000093349.1.61843 WP_000093349.1.6188 WP_000093349.1.619 WP_000093349.1.61903 WP_000093349.1.61910 WP_000093349.1.61936 WP_000093349.1.61962 WP_000093349.1.61970 WP_000093349.1.61976 WP_000093349.1.61978 WP_000093349.1.62002 WP_000093349.1.6201 WP_000093349.1.62028 WP_000093349.1.62030 WP_000093349.1.62069 WP_000093349.1.62088 WP_000093349.1.62093 WP_000093349.1.62096 WP_000093349.1.62127 WP_000093349.1.62140 WP_000093349.1.62164 WP_000093349.1.62247 WP_000093349.1.62254 WP_000093349.1.62318 WP_000093349.1.62346 WP_000093349.1.62352 WP_000093349.1.62367 WP_000093349.1.62382 WP_000093349.1.62392 WP_000093349.1.62398 WP_000093349.1.62409 WP_000093349.1.62429 WP_000093349.1.62437 WP_000093349.1.62453 WP_000093349.1.62459 WP_000093349.1.62462 WP_000093349.1.62474 WP_000093349.1.62496 WP_000093349.1.6250 WP_000093349.1.62537 WP_000093349.1.62539 WP_000093349.1.62553 WP_000093349.1.62563 WP_000093349.1.62575 WP_000093349.1.62602 WP_000093349.1.62630 WP_000093349.1.62653 WP_000093349.1.6266 WP_000093349.1.62671 WP_000093349.1.62674 WP_000093349.1.6268 WP_000093349.1.62684 WP_000093349.1.62685 WP_000093349.1.62723 WP_000093349.1.62740 WP_000093349.1.62764 WP_000093349.1.62771 WP_000093349.1.62796 WP_000093349.1.62808 WP_000093349.1.62822 WP_000093349.1.62824 WP_000093349.1.62829 WP_000093349.1.62831 WP_000093349.1.62842 WP_000093349.1.62863 WP_000093349.1.62878 WP_000093349.1.62880 WP_000093349.1.62925 WP_000093349.1.62956 WP_000093349.1.62970 WP_000093349.1.63003 WP_000093349.1.63004 WP_000093349.1.63011 WP_000093349.1.63021 WP_000093349.1.63027 WP_000093349.1.63050 WP_000093349.1.63068 WP_000093349.1.63070 WP_000093349.1.631 WP_000093349.1.63107 WP_000093349.1.63132 WP_000093349.1.63139 WP_000093349.1.63140 WP_000093349.1.63182 WP_000093349.1.63195 WP_000093349.1.63220 WP_000093349.1.63244 WP_000093349.1.63255 WP_000093349.1.63266 WP_000093349.1.63273 WP_000093349.1.63279 WP_000093349.1.63288 WP_000093349.1.63289 WP_000093349.1.63296 WP_000093349.1.63304 WP_000093349.1.63307 WP_000093349.1.63313 WP_000093349.1.63319 WP_000093349.1.63322 WP_000093349.1.63324 WP_000093349.1.63333 WP_000093349.1.63335 WP_000093349.1.63337 WP_000093349.1.63341 WP_000093349.1.63411 WP_000093349.1.63421 WP_000093349.1.63460 WP_000093349.1.63471 WP_000093349.1.63510 WP_000093349.1.63527 WP_000093349.1.63540 WP_000093349.1.6355 WP_000093349.1.63565 WP_000093349.1.63589 WP_000093349.1.63617 WP_000093349.1.63672 WP_000093349.1.63673 WP_000093349.1.63678 WP_000093349.1.63693 WP_000093349.1.63704 WP_000093349.1.63726 WP_000093349.1.63729 WP_000093349.1.6374 WP_000093349.1.63751 WP_000093349.1.63759 WP_000093349.1.63763 WP_000093349.1.63774 WP_000093349.1.6378 WP_000093349.1.63828 WP_000093349.1.63847 WP_000093349.1.63874 WP_000093349.1.6388 WP_000093349.1.63890 WP_000093349.1.63894 WP_000093349.1.63895 WP_000093349.1.63907 WP_000093349.1.63998 WP_000093349.1.64012 WP_000093349.1.6403 WP_000093349.1.64060 WP_000093349.1.6408 WP_000093349.1.64094 WP_000093349.1.64108 WP_000093349.1.64181 WP_000093349.1.64192 WP_000093349.1.64207 WP_000093349.1.64232 WP_000093349.1.64250 WP_000093349.1.64251 WP_000093349.1.64303 WP_000093349.1.64367 WP_000093349.1.64368 WP_000093349.1.6438 WP_000093349.1.64400 WP_000093349.1.64408 WP_000093349.1.64434 WP_000093349.1.64440 WP_000093349.1.64446 WP_000093349.1.64456 WP_000093349.1.64457 WP_000093349.1.64473 WP_000093349.1.645 WP_000093349.1.64525 WP_000093349.1.6453 WP_000093349.1.64537 WP_000093349.1.64565 WP_000093349.1.64583 WP_000093349.1.6459 WP_000093349.1.6462 WP_000093349.1.64630 WP_000093349.1.64665 WP_000093349.1.64677 WP_000093349.1.64686 WP_000093349.1.64720 WP_000093349.1.64765 WP_000093349.1.6479 WP_000093349.1.64811 WP_000093349.1.64845 WP_000093349.1.64858 WP_000093349.1.64860 WP_000093349.1.64879 WP_000093349.1.6488 WP_000093349.1.64893 WP_000093349.1.64897 WP_000093349.1.64911 WP_000093349.1.64928 WP_000093349.1.64935 WP_000093349.1.64951 WP_000093349.1.64961 WP_000093349.1.64994 WP_000093349.1.64996 WP_000093349.1.65025 WP_000093349.1.65033 WP_000093349.1.65038 WP_000093349.1.65044 WP_000093349.1.65046 WP_000093349.1.65076 WP_000093349.1.6509 WP_000093349.1.65132 WP_000093349.1.65158 WP_000093349.1.65164 WP_000093349.1.65180 WP_000093349.1.65193 WP_000093349.1.65203 WP_000093349.1.65233 WP_000093349.1.65243 WP_000093349.1.65274 WP_000093349.1.6531 WP_000093349.1.65317 WP_000093349.1.65367 WP_000093349.1.65387 WP_000093349.1.65406 WP_000093349.1.65407 WP_000093349.1.65419 WP_000093349.1.65423 WP_000093349.1.65432 WP_000093349.1.6544 WP_000093349.1.65443 WP_000093349.1.65448 WP_000093349.1.65451 WP_000093349.1.6547 WP_000093349.1.65504 WP_000093349.1.6551 WP_000093349.1.65520 WP_000093349.1.65544 WP_000093349.1.65562 WP_000093349.1.65585 WP_000093349.1.65599 WP_000093349.1.65600 WP_000093349.1.65616 WP_000093349.1.65629 WP_000093349.1.65643 WP_000093349.1.65656 WP_000093349.1.65675 WP_000093349.1.6568 WP_000093349.1.65689 WP_000093349.1.65693 WP_000093349.1.65700 WP_000093349.1.65703 WP_000093349.1.65704 WP_000093349.1.65705 WP_000093349.1.65713 WP_000093349.1.65734 WP_000093349.1.65769 WP_000093349.1.6578 WP_000093349.1.65809 WP_000093349.1.6585 WP_000093349.1.65856 WP_000093349.1.65892 WP_000093349.1.65922 WP_000093349.1.65928 WP_000093349.1.65931 WP_000093349.1.65935 WP_000093349.1.65947 WP_000093349.1.65948 WP_000093349.1.65965 WP_000093349.1.65990 WP_000093349.1.66009 WP_000093349.1.66014 WP_000093349.1.6603 WP_000093349.1.66054 WP_000093349.1.66069 WP_000093349.1.66073 WP_000093349.1.66081 WP_000093349.1.661 WP_000093349.1.66120 WP_000093349.1.66130 WP_000093349.1.66133 WP_000093349.1.66144 WP_000093349.1.66175 WP_000093349.1.66227 WP_000093349.1.66262 WP_000093349.1.66265 WP_000093349.1.66287 WP_000093349.1.66298 WP_000093349.1.66302 WP_000093349.1.6632 WP_000093349.1.66328 WP_000093349.1.66366 WP_000093349.1.66433 WP_000093349.1.66453 WP_000093349.1.66505 WP_000093349.1.66513 WP_000093349.1.66518 WP_000093349.1.66519 WP_000093349.1.66542 WP_000093349.1.66556 WP_000093349.1.66564 WP_000093349.1.66588 WP_000093349.1.66598 WP_000093349.1.66601 WP_000093349.1.66611 WP_000093349.1.66614 WP_000093349.1.6662 WP_000093349.1.66645 WP_000093349.1.66664 WP_000093349.1.66677 WP_000093349.1.6668 WP_000093349.1.66690 WP_000093349.1.66705 WP_000093349.1.66711 WP_000093349.1.6674 WP_000093349.1.66756 WP_000093349.1.66766 WP_000093349.1.66786 WP_000093349.1.66792 WP_000093349.1.66803 WP_000093349.1.66816 WP_000093349.1.66818 WP_000093349.1.6684 WP_000093349.1.66853 WP_000093349.1.66879 WP_000093349.1.6688 WP_000093349.1.66904 WP_000093349.1.66906 WP_000093349.1.66938 WP_000093349.1.66969 WP_000093349.1.67012 WP_000093349.1.67014 WP_000093349.1.67016 WP_000093349.1.67067 WP_000093349.1.67072 WP_000093349.1.67112 WP_000093349.1.67113 WP_000093349.1.67135 WP_000093349.1.67152 WP_000093349.1.67155 WP_000093349.1.67160 WP_000093349.1.67191 WP_000093349.1.6722 WP_000093349.1.67238 WP_000093349.1.67251 WP_000093349.1.67259 WP_000093349.1.6726 WP_000093349.1.67266 WP_000093349.1.67286 WP_000093349.1.67294 WP_000093349.1.67296 WP_000093349.1.67312 WP_000093349.1.67328 WP_000093349.1.67329 WP_000093349.1.67333 WP_000093349.1.67375 WP_000093349.1.67379 WP_000093349.1.6740 WP_000093349.1.67414 WP_000093349.1.67418 WP_000093349.1.67420 WP_000093349.1.67425 WP_000093349.1.67457 WP_000093349.1.67460 WP_000093349.1.67480 WP_000093349.1.67505 WP_000093349.1.67507 WP_000093349.1.67520 WP_000093349.1.67521 WP_000093349.1.67540 WP_000093349.1.67554 WP_000093349.1.67571 WP_000093349.1.67572 WP_000093349.1.67620 WP_000093349.1.67621 WP_000093349.1.67632 WP_000093349.1.67644 WP_000093349.1.67651 WP_000093349.1.67652 WP_000093349.1.67691 WP_000093349.1.67712 WP_000093349.1.67713 WP_000093349.1.67722 WP_000093349.1.67754 WP_000093349.1.67798 WP_000093349.1.67800 WP_000093349.1.67806 WP_000093349.1.67808 WP_000093349.1.67815 WP_000093349.1.67834 WP_000093349.1.6786 WP_000093349.1.67865 WP_000093349.1.67867 WP_000093349.1.67880 WP_000093349.1.67900 WP_000093349.1.67925 WP_000093349.1.67931 WP_000093349.1.67986 WP_000093349.1.67991 WP_000093349.1.68020 WP_000093349.1.68033 WP_000093349.1.68054 WP_000093349.1.68066 WP_000093349.1.68101 WP_000093349.1.6811 WP_000093349.1.68111 WP_000093349.1.68134 WP_000093349.1.68141 WP_000093349.1.68152 WP_000093349.1.68160 WP_000093349.1.68161 WP_000093349.1.68199 WP_000093349.1.68202 WP_000093349.1.68221 WP_000093349.1.68223 WP_000093349.1.68233 WP_000093349.1.6824 WP_000093349.1.68261 WP_000093349.1.68268 WP_000093349.1.68295 WP_000093349.1.68296 WP_000093349.1.68299 WP_000093349.1.6830 WP_000093349.1.68307 WP_000093349.1.68334 WP_000093349.1.6834 WP_000093349.1.68343 WP_000093349.1.68351 WP_000093349.1.68355 WP_000093349.1.68366 WP_000093349.1.68367 WP_000093349.1.6839 WP_000093349.1.68392 WP_000093349.1.68397 WP_000093349.1.68398 WP_000093349.1.68399 WP_000093349.1.68404 WP_000093349.1.68425 WP_000093349.1.68479 WP_000093349.1.68483 WP_000093349.1.68489 WP_000093349.1.68504 WP_000093349.1.68522 WP_000093349.1.68565 WP_000093349.1.686 WP_000093349.1.68636 WP_000093349.1.68650 WP_000093349.1.68681 WP_000093349.1.68683 WP_000093349.1.68699 WP_000093349.1.68703 WP_000093349.1.68728 WP_000093349.1.68737 WP_000093349.1.68741 WP_000093349.1.68743 WP_000093349.1.68747 WP_000093349.1.68773 WP_000093349.1.68775 WP_000093349.1.68813 WP_000093349.1.68831 WP_000093349.1.68854 WP_000093349.1.68864 WP_000093349.1.68875 WP_000093349.1.68883 WP_000093349.1.68931 WP_000093349.1.68943 WP_000093349.1.68944 WP_000093349.1.68998 WP_000093349.1.69012 WP_000093349.1.69016 WP_000093349.1.69045 WP_000093349.1.69071 WP_000093349.1.69078 WP_000093349.1.69087 WP_000093349.1.69089 WP_000093349.1.691 WP_000093349.1.69105 WP_000093349.1.6915 WP_000093349.1.69162 WP_000093349.1.6917 WP_000093349.1.69179 WP_000093349.1.69191 WP_000093349.1.69198 WP_000093349.1.69213 WP_000093349.1.69219 WP_000093349.1.69222 WP_000093349.1.69237 WP_000093349.1.69349 WP_000093349.1.69366 WP_000093349.1.69394 WP_000093349.1.69395 WP_000093349.1.69412 WP_000093349.1.69415 WP_000093349.1.69434 WP_000093349.1.69437 WP_000093349.1.69475 WP_000093349.1.69476 WP_000093349.1.69480 WP_000093349.1.69483 WP_000093349.1.69489 WP_000093349.1.695 WP_000093349.1.69520 WP_000093349.1.6953 WP_000093349.1.69546 WP_000093349.1.69552 WP_000093349.1.69563 WP_000093349.1.69598 WP_000093349.1.69622 WP_000093349.1.69639 WP_000093349.1.69679 WP_000093349.1.6968 WP_000093349.1.69683 WP_000093349.1.69721 WP_000093349.1.69724 WP_000093349.1.6980 WP_000093349.1.69820 WP_000093349.1.69823 WP_000093349.1.69830 WP_000093349.1.69842 WP_000093349.1.69877 WP_000093349.1.69878 WP_000093349.1.69882 WP_000093349.1.699 WP_000093349.1.69902 WP_000093349.1.69921 WP_000093349.1.69934 WP_000093349.1.69980 WP_000093349.1.69987 WP_000093349.1.69995 WP_000093349.1.70024 WP_000093349.1.70048 WP_000093349.1.70089 WP_000093349.1.70105 WP_000093349.1.7012 WP_000093349.1.70133 WP_000093349.1.70161 WP_000093349.1.70210 WP_000093349.1.70220 WP_000093349.1.70225 WP_000093349.1.70228 WP_000093349.1.7024 WP_000093349.1.70253 WP_000093349.1.70266 WP_000093349.1.70273 WP_000093349.1.70294 WP_000093349.1.70311 WP_000093349.1.70313 WP_000093349.1.70334 WP_000093349.1.7034 WP_000093349.1.70344 WP_000093349.1.70349 WP_000093349.1.70353 WP_000093349.1.7043 WP_000093349.1.70448 WP_000093349.1.70451 WP_000093349.1.70457 WP_000093349.1.70459 WP_000093349.1.7046 WP_000093349.1.70462 WP_000093349.1.70487 WP_000093349.1.70495 WP_000093349.1.70527 WP_000093349.1.7053 WP_000093349.1.70541 WP_000093349.1.70546 WP_000093349.1.70554 WP_000093349.1.70558 WP_000093349.1.70564 WP_000093349.1.7061 WP_000093349.1.70635 WP_000093349.1.7064 WP_000093349.1.70641 WP_000093349.1.7067 WP_000093349.1.70672 WP_000093349.1.707 WP_000093349.1.70721 WP_000093349.1.7073 WP_000093349.1.70763 WP_000093349.1.70808 WP_000093349.1.70818 WP_000093349.1.70823 WP_000093349.1.70829 WP_000093349.1.70835 WP_000093349.1.70843 WP_000093349.1.70850 WP_000093349.1.70855 WP_000093349.1.70909 WP_000093349.1.70924 WP_000093349.1.70926 WP_000093349.1.70930 WP_000093349.1.70943 WP_000093349.1.70994 WP_000093349.1.710 WP_000093349.1.71016 WP_000093349.1.71027 WP_000093349.1.71043 WP_000093349.1.7105 WP_000093349.1.71058 WP_000093349.1.71059 WP_000093349.1.71073 WP_000093349.1.7109 WP_000093349.1.71130 WP_000093349.1.71179 WP_000093349.1.71196 WP_000093349.1.7120 WP_000093349.1.71208 WP_000093349.1.71231 WP_000093349.1.71236 WP_000093349.1.7125 WP_000093349.1.71257 WP_000093349.1.71266 WP_000093349.1.71267 WP_000093349.1.71280 WP_000093349.1.71295 WP_000093349.1.71298 WP_000093349.1.71313 WP_000093349.1.71325 WP_000093349.1.71345 WP_000093349.1.71359 WP_000093349.1.71404 WP_000093349.1.71410 WP_000093349.1.71419 WP_000093349.1.71428 WP_000093349.1.71438 WP_000093349.1.71463 WP_000093349.1.71467 WP_000093349.1.71475 WP_000093349.1.71483 WP_000093349.1.7150 WP_000093349.1.71519 WP_000093349.1.71529 WP_000093349.1.71541 WP_000093349.1.71543 WP_000093349.1.71547 WP_000093349.1.71572 WP_000093349.1.71575 WP_000093349.1.71596 WP_000093349.1.71602 WP_000093349.1.7161 WP_000093349.1.71662 WP_000093349.1.71676 WP_000093349.1.71715 WP_000093349.1.71735 WP_000093349.1.71737 WP_000093349.1.71739 WP_000093349.1.71741 WP_000093349.1.71771 WP_000093349.1.7179 WP_000093349.1.71800 WP_000093349.1.71828 WP_000093349.1.71836 WP_000093349.1.71861 WP_000093349.1.71877 WP_000093349.1.71892 WP_000093349.1.71910 WP_000093349.1.71925 WP_000093349.1.71978 WP_000093349.1.71981 WP_000093349.1.71989 WP_000093349.1.72002 WP_000093349.1.72018 WP_000093349.1.72026 WP_000093349.1.72031 WP_000093349.1.72067 WP_000093349.1.72085 WP_000093349.1.72148 WP_000093349.1.72169 WP_000093349.1.72176 WP_000093349.1.72205 WP_000093349.1.72257 WP_000093349.1.72271 WP_000093349.1.72306 WP_000093349.1.72330 WP_000093349.1.72347 WP_000093349.1.7236 WP_000093349.1.72363 WP_000093349.1.72366 WP_000093349.1.72371 WP_000093349.1.72424 WP_000093349.1.72465 WP_000093349.1.72489 WP_000093349.1.72497 WP_000093349.1.72529 WP_000093349.1.72547 WP_000093349.1.7258 WP_000093349.1.7260 WP_000093349.1.72649 WP_000093349.1.72654 WP_000093349.1.72666 WP_000093349.1.72708 WP_000093349.1.72719 WP_000093349.1.72753 WP_000093349.1.72760 WP_000093349.1.72762 WP_000093349.1.72787 WP_000093349.1.72832 WP_000093349.1.72834 WP_000093349.1.72835 WP_000093349.1.72874 WP_000093349.1.72881 WP_000093349.1.72903 WP_000093349.1.72904 WP_000093349.1.72935 WP_000093349.1.7294 WP_000093349.1.72945 WP_000093349.1.72961 WP_000093349.1.72991 WP_000093349.1.73017 WP_000093349.1.73019 WP_000093349.1.73021 WP_000093349.1.73022 WP_000093349.1.73037 WP_000093349.1.73087 WP_000093349.1.73122 WP_000093349.1.73132 WP_000093349.1.73140 WP_000093349.1.73190 WP_000093349.1.73195 WP_000093349.1.73201 WP_000093349.1.73211 WP_000093349.1.73240 WP_000093349.1.73241 WP_000093349.1.73246 WP_000093349.1.73264 WP_000093349.1.73265 WP_000093349.1.73286 WP_000093349.1.73386 WP_000093349.1.73401 WP_000093349.1.73420 WP_000093349.1.73450 WP_000093349.1.73456 WP_000093349.1.73464 WP_000093349.1.73489 WP_000093349.1.73501 WP_000093349.1.73513 WP_000093349.1.73536 WP_000093349.1.73539 WP_000093349.1.73547 WP_000093349.1.73571 WP_000093349.1.73591 WP_000093349.1.736 WP_000093349.1.73610 WP_000093349.1.73639 WP_000093349.1.7365 WP_000093349.1.73674 WP_000093349.1.73685 WP_000093349.1.73687 WP_000093349.1.73694 WP_000093349.1.73735 WP_000093349.1.73740 WP_000093349.1.73759 WP_000093349.1.73786 WP_000093349.1.73789 WP_000093349.1.7380 WP_000093349.1.73834 WP_000093349.1.73837 WP_000093349.1.73858 WP_000093349.1.73868 WP_000093349.1.73885 WP_000093349.1.73900 WP_000093349.1.73910 WP_000093349.1.73920 WP_000093349.1.73921 WP_000093349.1.73940 WP_000093349.1.73949 WP_000093349.1.73961 WP_000093349.1.73969 WP_000093349.1.73971 WP_000093349.1.73976 WP_000093349.1.73983 WP_000093349.1.74004 WP_000093349.1.74006 WP_000093349.1.7401 WP_000093349.1.74010 WP_000093349.1.74025 WP_000093349.1.74027 WP_000093349.1.7406 WP_000093349.1.74073 WP_000093349.1.74081 WP_000093349.1.74085 WP_000093349.1.74155 WP_000093349.1.74157 WP_000093349.1.74161 WP_000093349.1.74172 WP_000093349.1.74173 WP_000093349.1.74183 WP_000093349.1.74216 WP_000093349.1.74237 WP_000093349.1.74242 WP_000093349.1.74257 WP_000093349.1.7427 WP_000093349.1.74273 WP_000093349.1.74284 WP_000093349.1.74295 WP_000093349.1.74327 WP_000093349.1.7434 WP_000093349.1.74353 WP_000093349.1.74356 WP_000093349.1.74429 WP_000093349.1.74456 WP_000093349.1.74457 WP_000093349.1.74533 WP_000093349.1.7457 WP_000093349.1.74576 WP_000093349.1.74587 WP_000093349.1.74610 WP_000093349.1.74638 WP_000093349.1.74676 WP_000093349.1.74681 WP_000093349.1.74704 WP_000093349.1.74731 WP_000093349.1.74747 WP_000093349.1.74758 WP_000093349.1.74770 WP_000093349.1.74785 WP_000093349.1.74797 WP_000093349.1.74802 WP_000093349.1.7482 WP_000093349.1.74866 WP_000093349.1.74874 WP_000093349.1.74890 WP_000093349.1.74911 WP_000093349.1.74922 WP_000093349.1.74924 WP_000093349.1.74961 WP_000093349.1.74985 WP_000093349.1.74994 WP_000093349.1.74999 WP_000093349.1.75038 WP_000093349.1.75044 WP_000093349.1.75048 WP_000093349.1.75052 WP_000093349.1.75070 WP_000093349.1.75093 WP_000093349.1.75111 WP_000093349.1.75127 WP_000093349.1.75131 WP_000093349.1.75132 WP_000093349.1.75141 WP_000093349.1.75186 WP_000093349.1.75227 WP_000093349.1.75252 WP_000093349.1.75253 WP_000093349.1.75294 WP_000093349.1.75298 WP_000093349.1.75320 WP_000093349.1.75323 WP_000093349.1.75349 WP_000093349.1.75351 WP_000093349.1.75356 WP_000093349.1.75365 WP_000093349.1.75399 WP_000093349.1.75409 WP_000093349.1.7542 WP_000093349.1.75438 WP_000093349.1.75440 WP_000093349.1.75521 WP_000093349.1.75527 WP_000093349.1.75538 WP_000093349.1.75551 WP_000093349.1.75566 WP_000093349.1.75571 WP_000093349.1.75590 WP_000093349.1.7561 WP_000093349.1.75647 WP_000093349.1.75649 WP_000093349.1.75652 WP_000093349.1.75685 WP_000093349.1.75692 WP_000093349.1.75704 WP_000093349.1.75728 WP_000093349.1.75743 WP_000093349.1.75769 WP_000093349.1.758 WP_000093349.1.75805 WP_000093349.1.75809 WP_000093349.1.75830 WP_000093349.1.75840 WP_000093349.1.75848 WP_000093349.1.75851 WP_000093349.1.75862 WP_000093349.1.75881 WP_000093349.1.75885 WP_000093349.1.75910 WP_000093349.1.75929 WP_000093349.1.75944 WP_000093349.1.75952 WP_000093349.1.75956 WP_000093349.1.7596 WP_000093349.1.75969 WP_000093349.1.76010 WP_000093349.1.76013 WP_000093349.1.76015 WP_000093349.1.7602 WP_000093349.1.76047 WP_000093349.1.76049 WP_000093349.1.76050 WP_000093349.1.76053 WP_000093349.1.76095 WP_000093349.1.76104 WP_000093349.1.76111 WP_000093349.1.76114 WP_000093349.1.76121 WP_000093349.1.76123 WP_000093349.1.76143 WP_000093349.1.76153 WP_000093349.1.76179 WP_000093349.1.76230 WP_000093349.1.76234 WP_000093349.1.7624 WP_000093349.1.7625 WP_000093349.1.76258 WP_000093349.1.76261 WP_000093349.1.76283 WP_000093349.1.76313 WP_000093349.1.76332 WP_000093349.1.76337 WP_000093349.1.76351 WP_000093349.1.76419 WP_000093349.1.76420 WP_000093349.1.76421 WP_000093349.1.76424 WP_000093349.1.76426 WP_000093349.1.76431 WP_000093349.1.76463 WP_000093349.1.76497 WP_000093349.1.76606 WP_000093349.1.76624 WP_000093349.1.76648 WP_000093349.1.76659 WP_000093349.1.76686 WP_000093349.1.76689 WP_000093349.1.76690 WP_000093349.1.76693 WP_000093349.1.76711 WP_000093349.1.76718 WP_000093349.1.7675 WP_000093349.1.76790 WP_000093349.1.76792 WP_000093349.1.76798 WP_000093349.1.768 WP_000093349.1.76803 WP_000093349.1.76816 WP_000093349.1.76829 WP_000093349.1.76839 WP_000093349.1.76845 WP_000093349.1.76869 WP_000093349.1.76895 WP_000093349.1.76897 WP_000093349.1.76921 WP_000093349.1.7694 WP_000093349.1.76944 WP_000093349.1.76952 WP_000093349.1.76998 WP_000093349.1.77031 WP_000093349.1.77041 WP_000093349.1.77043 WP_000093349.1.77050 WP_000093349.1.77060 WP_000093349.1.77062 WP_000093349.1.77072 WP_000093349.1.77112 WP_000093349.1.77137 WP_000093349.1.77144 WP_000093349.1.77145 WP_000093349.1.77190 WP_000093349.1.77203 WP_000093349.1.77229 WP_000093349.1.77298 WP_000093349.1.77305 WP_000093349.1.77331 WP_000093349.1.77346 WP_000093349.1.77359 WP_000093349.1.77388 WP_000093349.1.7745 WP_000093349.1.7746 WP_000093349.1.77485 WP_000093349.1.77489 WP_000093349.1.77498 WP_000093349.1.7752 WP_000093349.1.77520 WP_000093349.1.77527 WP_000093349.1.77532 WP_000093349.1.77533 WP_000093349.1.77536 WP_000093349.1.77572 WP_000093349.1.77583 WP_000093349.1.77603 WP_000093349.1.77606 WP_000093349.1.77650 WP_000093349.1.77735 WP_000093349.1.77738 WP_000093349.1.7774 WP_000093349.1.77743 WP_000093349.1.77791 WP_000093349.1.77822 WP_000093349.1.77848 WP_000093349.1.7785 WP_000093349.1.7786 WP_000093349.1.77860 WP_000093349.1.7787 WP_000093349.1.77882 WP_000093349.1.77883 WP_000093349.1.77915 WP_000093349.1.77922 WP_000093349.1.77930 WP_000093349.1.77957 WP_000093349.1.77986 WP_000093349.1.78038 WP_000093349.1.78054 WP_000093349.1.78082 WP_000093349.1.78091 WP_000093349.1.7810 WP_000093349.1.78164 WP_000093349.1.78173 WP_000093349.1.78179 WP_000093349.1.78189 WP_000093349.1.78194 WP_000093349.1.78207 WP_000093349.1.78208 WP_000093349.1.78252 WP_000093349.1.78254 WP_000093349.1.78257 WP_000093349.1.7827 WP_000093349.1.78304 WP_000093349.1.78311 WP_000093349.1.78324 WP_000093349.1.7833 WP_000093349.1.78330 WP_000093349.1.78365 WP_000093349.1.78371 WP_000093349.1.78392 WP_000093349.1.78404 WP_000093349.1.78434 WP_000093349.1.78436 WP_000093349.1.78470 WP_000093349.1.78489 WP_000093349.1.78494 WP_000093349.1.7850 WP_000093349.1.78513 WP_000093349.1.7853 WP_000093349.1.78558 WP_000093349.1.7857 WP_000093349.1.78573 WP_000093349.1.78585 WP_000093349.1.78592 WP_000093349.1.78598 WP_000093349.1.78604 WP_000093349.1.78638 WP_000093349.1.78653 WP_000093349.1.78667 WP_000093349.1.7868 WP_000093349.1.78685 WP_000093349.1.78728 WP_000093349.1.78731 WP_000093349.1.78736 WP_000093349.1.78763 WP_000093349.1.78785 WP_000093349.1.78803 WP_000093349.1.78816 WP_000093349.1.78819 WP_000093349.1.78841 WP_000093349.1.78897 WP_000093349.1.78920 WP_000093349.1.78937 WP_000093349.1.78946 WP_000093349.1.78978 WP_000093349.1.78983 WP_000093349.1.78991 WP_000093349.1.78995 WP_000093349.1.7900 WP_000093349.1.79006 WP_000093349.1.79038 WP_000093349.1.7905 WP_000093349.1.79051 WP_000093349.1.79059 WP_000093349.1.79085 WP_000093349.1.79110 WP_000093349.1.79131 WP_000093349.1.7914 WP_000093349.1.79143 WP_000093349.1.79156 WP_000093349.1.79170 WP_000093349.1.79178 WP_000093349.1.79192 WP_000093349.1.79197 WP_000093349.1.79208 WP_000093349.1.79223 WP_000093349.1.79270 WP_000093349.1.79275 WP_000093349.1.79285 WP_000093349.1.7931 WP_000093349.1.79310 WP_000093349.1.79322 WP_000093349.1.79332 WP_000093349.1.7934 WP_000093349.1.79367 WP_000093349.1.79374 WP_000093349.1.79378 WP_000093349.1.79400 WP_000093349.1.79452 WP_000093349.1.79461 WP_000093349.1.79476 WP_000093349.1.79487 WP_000093349.1.79539 WP_000093349.1.79552 WP_000093349.1.79556 WP_000093349.1.79626 WP_000093349.1.79627 WP_000093349.1.79662 WP_000093349.1.79664 WP_000093349.1.79672 WP_000093349.1.79677 WP_000093349.1.79706 WP_000093349.1.79731 WP_000093349.1.79737 WP_000093349.1.79763 WP_000093349.1.7981 WP_000093349.1.79815 WP_000093349.1.79822 WP_000093349.1.79831 WP_000093349.1.79834 WP_000093349.1.79837 WP_000093349.1.79854 WP_000093349.1.7989 WP_000093349.1.79896 WP_000093349.1.79904 WP_000093349.1.79911 WP_000093349.1.7992 WP_000093349.1.79941 WP_000093349.1.79949 WP_000093349.1.79961 WP_000093349.1.79971 WP_000093349.1.79991 WP_000093349.1.80000 WP_000093349.1.80009 WP_000093349.1.80013 WP_000093349.1.80029 WP_000093349.1.80032 WP_000093349.1.80042 WP_000093349.1.80079 WP_000093349.1.80086 WP_000093349.1.80109 WP_000093349.1.80119 WP_000093349.1.80120 WP_000093349.1.80127 WP_000093349.1.80146 WP_000093349.1.80152 WP_000093349.1.80178 WP_000093349.1.80181 WP_000093349.1.80184 WP_000093349.1.80203 WP_000093349.1.80244 WP_000093349.1.80274 WP_000093349.1.80286 WP_000093349.1.80287 WP_000093349.1.80290 WP_000093349.1.8030 WP_000093349.1.80316 WP_000093349.1.80317 WP_000093349.1.8035 WP_000093349.1.80358 WP_000093349.1.80378 WP_000093349.1.80389 WP_000093349.1.80393 WP_000093349.1.8040 WP_000093349.1.8043 WP_000093349.1.80434 WP_000093349.1.80472 WP_000093349.1.80521 WP_000093349.1.80530 WP_000093349.1.80582 WP_000093349.1.80647 WP_000093349.1.8065 WP_000093349.1.80687 WP_000093349.1.80717 WP_000093349.1.80745 WP_000093349.1.80761 WP_000093349.1.80762 WP_000093349.1.80763 WP_000093349.1.8077 WP_000093349.1.80786 WP_000093349.1.80833 WP_000093349.1.8084 WP_000093349.1.80855 WP_000093349.1.80872 WP_000093349.1.80899 WP_000093349.1.80962 WP_000093349.1.80972 WP_000093349.1.81010 WP_000093349.1.81022 WP_000093349.1.81049 WP_000093349.1.81052 WP_000093349.1.81064 WP_000093349.1.81065 WP_000093349.1.81085 WP_000093349.1.81095 WP_000093349.1.81114 WP_000093349.1.81132 WP_000093349.1.81151 WP_000093349.1.81157 WP_000093349.1.81171 WP_000093349.1.81172 WP_000093349.1.81176 WP_000093349.1.81184 WP_000093349.1.81214 WP_000093349.1.81224 WP_000093349.1.81228 WP_000093349.1.81232 WP_000093349.1.81234 WP_000093349.1.81243 WP_000093349.1.8125 WP_000093349.1.81252 WP_000093349.1.81288 WP_000093349.1.8135 WP_000093349.1.81379 WP_000093349.1.81384 WP_000093349.1.81385 WP_000093349.1.81387 WP_000093349.1.81389 WP_000093349.1.8142 WP_000093349.1.8144 WP_000093349.1.81464 WP_000093349.1.81467 WP_000093349.1.81508 WP_000093349.1.81532 WP_000093349.1.81574 WP_000093349.1.81599 WP_000093349.1.8160 WP_000093349.1.81604 WP_000093349.1.81610 WP_000093349.1.81619 WP_000093349.1.81645 WP_000093349.1.81718 WP_000093349.1.81738 WP_000093349.1.81740 WP_000093349.1.81758 WP_000093349.1.81789 WP_000093349.1.8180 WP_000093349.1.81800 WP_000093349.1.81810 WP_000093349.1.81812 WP_000093349.1.81829 WP_000093349.1.81831 WP_000093349.1.81838 WP_000093349.1.8185 WP_000093349.1.81861 WP_000093349.1.81870 WP_000093349.1.81897 WP_000093349.1.81903 WP_000093349.1.81905 WP_000093349.1.81906 WP_000093349.1.81919 WP_000093349.1.81944 WP_000093349.1.81955 WP_000093349.1.81969 WP_000093349.1.81982 WP_000093349.1.81990 WP_000093349.1.81999 WP_000093349.1.82009 WP_000093349.1.82017 WP_000093349.1.82053 WP_000093349.1.8206 WP_000093349.1.8212 WP_000093349.1.82121 WP_000093349.1.8213 WP_000093349.1.82174 WP_000093349.1.82184 WP_000093349.1.82219 WP_000093349.1.82234 WP_000093349.1.82247 WP_000093349.1.82253 WP_000093349.1.82259 WP_000093349.1.82281 WP_000093349.1.82301 WP_000093349.1.82315 WP_000093349.1.82340 WP_000093349.1.82349 WP_000093349.1.82358 WP_000093349.1.82368 WP_000093349.1.82406 WP_000093349.1.82441 WP_000093349.1.82447 WP_000093349.1.82455 WP_000093349.1.82458 WP_000093349.1.8246 WP_000093349.1.82467 WP_000093349.1.82468 WP_000093349.1.82525 WP_000093349.1.82548 WP_000093349.1.82558 WP_000093349.1.8261 WP_000093349.1.82612 WP_000093349.1.8265 WP_000093349.1.8266 WP_000093349.1.82664 WP_000093349.1.82678 WP_000093349.1.82709 WP_000093349.1.82724 WP_000093349.1.82768 WP_000093349.1.82775 WP_000093349.1.82796 WP_000093349.1.8280 WP_000093349.1.82802 WP_000093349.1.82824 WP_000093349.1.82829 WP_000093349.1.82855 WP_000093349.1.82862 WP_000093349.1.8288 WP_000093349.1.8289 WP_000093349.1.82930 WP_000093349.1.82941 WP_000093349.1.82976 WP_000093349.1.82980 WP_000093349.1.8302 WP_000093349.1.83021 WP_000093349.1.83046 WP_000093349.1.83054 WP_000093349.1.83066 WP_000093349.1.83078 WP_000093349.1.8310 WP_000093349.1.83103 WP_000093349.1.83152 WP_000093349.1.83153 WP_000093349.1.8318 WP_000093349.1.83185 WP_000093349.1.8319 WP_000093349.1.83193 WP_000093349.1.83203 WP_000093349.1.83234 WP_000093349.1.83249 WP_000093349.1.83250 WP_000093349.1.83291 WP_000093349.1.83316 WP_000093349.1.83352 WP_000093349.1.83359 WP_000093349.1.83372 WP_000093349.1.83405 WP_000093349.1.83417 WP_000093349.1.83418 WP_000093349.1.8346 WP_000093349.1.83467 WP_000093349.1.83468 WP_000093349.1.83472 WP_000093349.1.83476 WP_000093349.1.83479 WP_000093349.1.83484 WP_000093349.1.83508 WP_000093349.1.83517 WP_000093349.1.83520 WP_000093349.1.83553 WP_000093349.1.83593 WP_000093349.1.83597 WP_000093349.1.83646 WP_000093349.1.83653 WP_000093349.1.8366 WP_000093349.1.83674 WP_000093349.1.83676 WP_000093349.1.83720 WP_000093349.1.83728 WP_000093349.1.83750 WP_000093349.1.83756 WP_000093349.1.83758 WP_000093349.1.83763 WP_000093349.1.83769 WP_000093349.1.83775 WP_000093349.1.83788 WP_000093349.1.83792 WP_000093349.1.83797 WP_000093349.1.83804 WP_000093349.1.83816 WP_000093349.1.83825 WP_000093349.1.8383 WP_000093349.1.83844 WP_000093349.1.83864 WP_000093349.1.83865 WP_000093349.1.83881 WP_000093349.1.83886 WP_000093349.1.83905 WP_000093349.1.83912 WP_000093349.1.83919 WP_000093349.1.83928 WP_000093349.1.83955 WP_000093349.1.83984 WP_000093349.1.83989 WP_000093349.1.84010 WP_000093349.1.84025 WP_000093349.1.84049 WP_000093349.1.84054 WP_000093349.1.84064 WP_000093349.1.84118 WP_000093349.1.84129 WP_000093349.1.84144 WP_000093349.1.84161 WP_000093349.1.84163 WP_000093349.1.84188 WP_000093349.1.84194 WP_000093349.1.84275 WP_000093349.1.8432 WP_000093349.1.84342 WP_000093349.1.84414 WP_000093349.1.84415 WP_000093349.1.84418 WP_000093349.1.84442 WP_000093349.1.84445 WP_000093349.1.84451 WP_000093349.1.84509 WP_000093349.1.84563 WP_000093349.1.84578 WP_000093349.1.84590 WP_000093349.1.84596 WP_000093349.1.84608 WP_000093349.1.8462 WP_000093349.1.84625 WP_000093349.1.84638 WP_000093349.1.84648 WP_000093349.1.84673 WP_000093349.1.84679 WP_000093349.1.8468 WP_000093349.1.84682 WP_000093349.1.84696 WP_000093349.1.84714 WP_000093349.1.84736 WP_000093349.1.8475 WP_000093349.1.84752 WP_000093349.1.84757 WP_000093349.1.84761 WP_000093349.1.84815 WP_000093349.1.84826 WP_000093349.1.84847 WP_000093349.1.84854 WP_000093349.1.84874 WP_000093349.1.84889 WP_000093349.1.84903 WP_000093349.1.84907 WP_000093349.1.84922 WP_000093349.1.84924 WP_000093349.1.8493 WP_000093349.1.84943 WP_000093349.1.84951 WP_000093349.1.8496 WP_000093349.1.84975 WP_000093349.1.84978 WP_000093349.1.85017 WP_000093349.1.85022 WP_000093349.1.85026 WP_000093349.1.85045 WP_000093349.1.85047 WP_000093349.1.85056 WP_000093349.1.85070 WP_000093349.1.85081 WP_000093349.1.85099 WP_000093349.1.85132 WP_000093349.1.85133 WP_000093349.1.85135 WP_000093349.1.85144 WP_000093349.1.85151 WP_000093349.1.85160 WP_000093349.1.85198 WP_000093349.1.85226 WP_000093349.1.85229 WP_000093349.1.85235 WP_000093349.1.85238 WP_000093349.1.85265 WP_000093349.1.85289 WP_000093349.1.85292 WP_000093349.1.85331 WP_000093349.1.85351 WP_000093349.1.85354 WP_000093349.1.85375 WP_000093349.1.85376 WP_000093349.1.85383 WP_000093349.1.85391 WP_000093349.1.85395 WP_000093349.1.85401 WP_000093349.1.85404 WP_000093349.1.85409 WP_000093349.1.85425 WP_000093349.1.85441 WP_000093349.1.85445 WP_000093349.1.85462 WP_000093349.1.85471 WP_000093349.1.85474 WP_000093349.1.85492 WP_000093349.1.85506 WP_000093349.1.8551 WP_000093349.1.85515 WP_000093349.1.85519 WP_000093349.1.85547 WP_000093349.1.85549 WP_000093349.1.85562 WP_000093349.1.85586 WP_000093349.1.85596 WP_000093349.1.85611 WP_000093349.1.85634 WP_000093349.1.85649 WP_000093349.1.85730 WP_000093349.1.85732 WP_000093349.1.85758 WP_000093349.1.85795 WP_000093349.1.85796 WP_000093349.1.85834 WP_000093349.1.85858 WP_000093349.1.85873 WP_000093349.1.85906 WP_000093349.1.85924 WP_000093349.1.85927 WP_000093349.1.85950 WP_000093349.1.85971 WP_000093349.1.85980 WP_000093349.1.85989 WP_000093349.1.85993 WP_000093349.1.86018 WP_000093349.1.86036 WP_000093349.1.86042 WP_000093349.1.86072 WP_000093349.1.86086 WP_000093349.1.86136 WP_000093349.1.86144 WP_000093349.1.86153 WP_000093349.1.86154 WP_000093349.1.86158 WP_000093349.1.8617 WP_000093349.1.86188 WP_000093349.1.86197 WP_000093349.1.86207 WP_000093349.1.86209 WP_000093349.1.8627 WP_000093349.1.86270 WP_000093349.1.86281 WP_000093349.1.86304 WP_000093349.1.86315 WP_000093349.1.86331 WP_000093349.1.86344 WP_000093349.1.86363 WP_000093349.1.86367 WP_000093349.1.86378 WP_000093349.1.8641 WP_000093349.1.8643 WP_000093349.1.86439 WP_000093349.1.86455 WP_000093349.1.86482 WP_000093349.1.86523 WP_000093349.1.86531 WP_000093349.1.86542 WP_000093349.1.86606 WP_000093349.1.86628 WP_000093349.1.8663 WP_000093349.1.86664 WP_000093349.1.86704 WP_000093349.1.86706 WP_000093349.1.86736 WP_000093349.1.86745 WP_000093349.1.86792 WP_000093349.1.86793 WP_000093349.1.86795 WP_000093349.1.8681 WP_000093349.1.86838 WP_000093349.1.8690 WP_000093349.1.86911 WP_000093349.1.86916 WP_000093349.1.86940 WP_000093349.1.86942 WP_000093349.1.86961 WP_000093349.1.86968 WP_000093349.1.86977 WP_000093349.1.86999 WP_000093349.1.87021 WP_000093349.1.87042 WP_000093349.1.87057 WP_000093349.1.87072 WP_000093349.1.87088 WP_000093349.1.87090 WP_000093349.1.87097 WP_000093349.1.87100 WP_000093349.1.87119 WP_000093349.1.87122 WP_000093349.1.87133 WP_000093349.1.87137 WP_000093349.1.87141 WP_000093349.1.87168 WP_000093349.1.87175 WP_000093349.1.87190 WP_000093349.1.87194 WP_000093349.1.8720 WP_000093349.1.87221 WP_000093349.1.87236 WP_000093349.1.87261 WP_000093349.1.87272 WP_000093349.1.87285 WP_000093349.1.87290 WP_000093349.1.87296 WP_000093349.1.8731 WP_000093349.1.87363 WP_000093349.1.87372 WP_000093349.1.87388 WP_000093349.1.87396 WP_000093349.1.87457 WP_000093349.1.87461 WP_000093349.1.87466 WP_000093349.1.87486 WP_000093349.1.875 WP_000093349.1.87508 WP_000093349.1.87511 WP_000093349.1.87515 WP_000093349.1.8753 WP_000093349.1.87534 WP_000093349.1.87541 WP_000093349.1.87543 WP_000093349.1.87593 WP_000093349.1.87595 WP_000093349.1.87636 WP_000093349.1.8764 WP_000093349.1.87682 WP_000093349.1.8770 WP_000093349.1.87710 WP_000093349.1.87734 WP_000093349.1.87745 WP_000093349.1.87748 WP_000093349.1.87764 WP_000093349.1.87782 WP_000093349.1.8779 WP_000093349.1.87808 WP_000093349.1.87828 WP_000093349.1.87838 WP_000093349.1.87841 WP_000093349.1.87854 WP_000093349.1.87865 WP_000093349.1.87879 WP_000093349.1.8791 WP_000093349.1.87912 WP_000093349.1.87937 WP_000093349.1.87948 WP_000093349.1.87963 WP_000093349.1.87964 WP_000093349.1.87967 WP_000093349.1.87972 WP_000093349.1.87995 WP_000093349.1.88013 WP_000093349.1.88032 WP_000093349.1.88061 WP_000093349.1.88114 WP_000093349.1.88150 WP_000093349.1.88169 WP_000093349.1.88212 WP_000093349.1.88270 WP_000093349.1.88309 WP_000093349.1.88317 WP_000093349.1.88319 WP_000093349.1.88339 WP_000093349.1.88351 WP_000093349.1.88367 WP_000093349.1.88371 WP_000093349.1.88375 WP_000093349.1.88380 WP_000093349.1.88418 WP_000093349.1.88430 WP_000093349.1.88440 WP_000093349.1.88445 WP_000093349.1.88449 WP_000093349.1.8847 WP_000093349.1.88473 WP_000093349.1.88480 WP_000093349.1.88498 WP_000093349.1.88504 WP_000093349.1.88518 WP_000093349.1.88555 WP_000093349.1.88563 WP_000093349.1.8857 WP_000093349.1.88572 WP_000093349.1.88580 WP_000093349.1.88583 WP_000093349.1.88585 WP_000093349.1.8859 WP_000093349.1.88599 WP_000093349.1.88600 WP_000093349.1.88614 WP_000093349.1.88623 WP_000093349.1.88636 WP_000093349.1.88638 WP_000093349.1.88642 WP_000093349.1.88671 WP_000093349.1.88694 WP_000093349.1.88696 WP_000093349.1.8872 WP_000093349.1.88739 WP_000093349.1.88753 WP_000093349.1.88761 WP_000093349.1.8877 WP_000093349.1.88771 WP_000093349.1.88781 WP_000093349.1.88843 WP_000093349.1.88856 WP_000093349.1.88859 WP_000093349.1.8886 WP_000093349.1.88878 WP_000093349.1.8888 WP_000093349.1.88881 WP_000093349.1.88897 WP_000093349.1.88922 WP_000093349.1.88934 WP_000093349.1.88954 WP_000093349.1.88962 WP_000093349.1.8900 WP_000093349.1.89012 WP_000093349.1.89024 WP_000093349.1.89027 WP_000093349.1.89036 WP_000093349.1.89086 WP_000093349.1.89108 WP_000093349.1.8913 WP_000093349.1.89133 WP_000093349.1.89139 WP_000093349.1.89164 WP_000093349.1.8918 WP_000093349.1.89181 WP_000093349.1.89184 WP_000093349.1.89194 WP_000093349.1.89195 WP_000093349.1.89204 WP_000093349.1.89216 WP_000093349.1.8924 WP_000093349.1.89284 WP_000093349.1.89290 WP_000093349.1.89348 WP_000093349.1.89350 WP_000093349.1.89372 WP_000093349.1.89390 WP_000093349.1.89404 WP_000093349.1.89433 WP_000093349.1.89476 WP_000093349.1.8950 WP_000093349.1.89537 WP_000093349.1.89544 WP_000093349.1.89545 WP_000093349.1.89556 WP_000093349.1.89557 WP_000093349.1.89559 WP_000093349.1.89603 WP_000093349.1.89655 WP_000093349.1.89672 WP_000093349.1.89678 WP_000093349.1.89686 WP_000093349.1.89726 WP_000093349.1.89730 WP_000093349.1.89754 WP_000093349.1.89779 WP_000093349.1.89794 WP_000093349.1.89799 WP_000093349.1.898 WP_000093349.1.89857 WP_000093349.1.89863 WP_000093349.1.89883 WP_000093349.1.89908 WP_000093349.1.89924 WP_000093349.1.89935 WP_000093349.1.89949 WP_000093349.1.89950 WP_000093349.1.89960 WP_000093349.1.90005 WP_000093349.1.90018 WP_000093349.1.90038 WP_000093349.1.90046 WP_000093349.1.90055 WP_000093349.1.90069 WP_000093349.1.90091 WP_000093349.1.90095 WP_000093349.1.90131 WP_000093349.1.90145 WP_000093349.1.90148 WP_000093349.1.90161 WP_000093349.1.90173 WP_000093349.1.90174 WP_000093349.1.90180 WP_000093349.1.90215 WP_000093349.1.90217 WP_000093349.1.9022 WP_000093349.1.90243 WP_000093349.1.90246 WP_000093349.1.90250 WP_000093349.1.90253 WP_000093349.1.90276 WP_000093349.1.9030 WP_000093349.1.90307 WP_000093349.1.90331 WP_000093349.1.90345 WP_000093349.1.90367 WP_000093349.1.90370 WP_000093349.1.90386 WP_000093349.1.90447 WP_000093349.1.90454 WP_000093349.1.90473 WP_000093349.1.90475 WP_000093349.1.90488 WP_000093349.1.90506 WP_000093349.1.90533 WP_000093349.1.90544 WP_000093349.1.9055 WP_000093349.1.90554 WP_000093349.1.90556 WP_000093349.1.90604 WP_000093349.1.90647 WP_000093349.1.90660 WP_000093349.1.90683 WP_000093349.1.90698 WP_000093349.1.9071 WP_000093349.1.90726 WP_000093349.1.90728 WP_000093349.1.90738 WP_000093349.1.90740 WP_000093349.1.90745 WP_000093349.1.90757 WP_000093349.1.9076 WP_000093349.1.90801 WP_000093349.1.90804 WP_000093349.1.90818 WP_000093349.1.90820 WP_000093349.1.90861 WP_000093349.1.90896 WP_000093349.1.90903 WP_000093349.1.90923 WP_000093349.1.9100 WP_000093349.1.91005 WP_000093349.1.91011 WP_000093349.1.91019 WP_000093349.1.91054 WP_000093349.1.91124 WP_000093349.1.91126 WP_000093349.1.9114 WP_000093349.1.91150 WP_000093349.1.91158 WP_000093349.1.91177 WP_000093349.1.912 WP_000093349.1.9122 WP_000093349.1.91246 WP_000093349.1.91258 WP_000093349.1.91279 WP_000093349.1.91280 WP_000093349.1.91297 WP_000093349.1.91300 WP_000093349.1.91332 WP_000093349.1.91346 WP_000093349.1.91357 WP_000093349.1.91364 WP_000093349.1.91371 WP_000093349.1.91382 WP_000093349.1.9140 WP_000093349.1.91420 WP_000093349.1.91427 WP_000093349.1.91447 WP_000093349.1.91486 WP_000093349.1.91487 WP_000093349.1.91500 WP_000093349.1.91525 WP_000093349.1.9153 WP_000093349.1.91530 WP_000093349.1.9155 WP_000093349.1.91559 WP_000093349.1.91573 WP_000093349.1.91581 WP_000093349.1.91586 WP_000093349.1.91587 WP_000093349.1.91611 WP_000093349.1.91624 WP_000093349.1.91634 WP_000093349.1.91639 WP_000093349.1.91660 WP_000093349.1.91670 WP_000093349.1.917 WP_000093349.1.91704 WP_000093349.1.91745 WP_000093349.1.91746 WP_000093349.1.91749 WP_000093349.1.91771 WP_000093349.1.91791 WP_000093349.1.91800 WP_000093349.1.91816 WP_000093349.1.91829 WP_000093349.1.91848 WP_000093349.1.91895 WP_000093349.1.91909 WP_000093349.1.91918 WP_000093349.1.91919 WP_000093349.1.91928 WP_000093349.1.91950 WP_000093349.1.92 WP_000093349.1.92080 WP_000093349.1.92125 WP_000093349.1.92133 WP_000093349.1.92140 WP_000093349.1.92143 WP_000093349.1.92147 WP_000093349.1.92164 WP_000093349.1.92169 WP_000093349.1.92173 WP_000093349.1.92185 WP_000093349.1.92186 WP_000093349.1.92196 WP_000093349.1.92212 WP_000093349.1.92227 WP_000093349.1.92228 WP_000093349.1.9224 WP_000093349.1.92244 WP_000093349.1.92249 WP_000093349.1.92253 WP_000093349.1.92254 WP_000093349.1.92297 WP_000093349.1.923 WP_000093349.1.92303 WP_000093349.1.9237 WP_000093349.1.9239 WP_000093349.1.92391 WP_000093349.1.92405 WP_000093349.1.92425 WP_000093349.1.92436 WP_000093349.1.92442 WP_000093349.1.9247 WP_000093349.1.92479 WP_000093349.1.92488 WP_000093349.1.92497 WP_000093349.1.92500 WP_000093349.1.92512 WP_000093349.1.92520 WP_000093349.1.92534 WP_000093349.1.92541 WP_000093349.1.92546 WP_000093349.1.92565 WP_000093349.1.92602 WP_000093349.1.92607 WP_000093349.1.92667 WP_000093349.1.92674 WP_000093349.1.92679 WP_000093349.1.92688 WP_000093349.1.92691 WP_000093349.1.92718 WP_000093349.1.92723 WP_000093349.1.92735 WP_000093349.1.92741 WP_000093349.1.92765 WP_000093349.1.92773 WP_000093349.1.92789 WP_000093349.1.92795 WP_000093349.1.92805 WP_000093349.1.9286 WP_000093349.1.92862 WP_000093349.1.92864 WP_000093349.1.92918 WP_000093349.1.9293 WP_000093349.1.92950 WP_000093349.1.9296 WP_000093349.1.92960 WP_000093349.1.92965 WP_000093349.1.92997 WP_000093349.1.93047 WP_000093349.1.9305 WP_000093349.1.93071 WP_000093349.1.93074 WP_000093349.1.93125 WP_000093349.1.93147 WP_000093349.1.93163 WP_000093349.1.93176 WP_000093349.1.93191 WP_000093349.1.93197 WP_000093349.1.93211 WP_000093349.1.93224 WP_000093349.1.93231 WP_000093349.1.93243 WP_000093349.1.93254 WP_000093349.1.93260 WP_000093349.1.93263 WP_000093349.1.93296 WP_000093349.1.9330 WP_000093349.1.93300 WP_000093349.1.93336 WP_000093349.1.93374 WP_000093349.1.93378 WP_000093349.1.93416 WP_000093349.1.93438 WP_000093349.1.93444 WP_000093349.1.93471 WP_000093349.1.93514 WP_000093349.1.9352 WP_000093349.1.93538 WP_000093349.1.9354 WP_000093349.1.93579 WP_000093349.1.9358 WP_000093349.1.93590 WP_000093349.1.93647 WP_000093349.1.93658 WP_000093349.1.93669 WP_000093349.1.93678 WP_000093349.1.93708 WP_000093349.1.93710 WP_000093349.1.93722 WP_000093349.1.93736 WP_000093349.1.93738 WP_000093349.1.93758 WP_000093349.1.93762 WP_000093349.1.93769 WP_000093349.1.93775 WP_000093349.1.93787 WP_000093349.1.9387 WP_000093349.1.93882 WP_000093349.1.93883 WP_000093349.1.93890 WP_000093349.1.93891 WP_000093349.1.93975 WP_000093349.1.93976 WP_000093349.1.9398 WP_000093349.1.93981 WP_000093349.1.94 WP_000093349.1.94053 WP_000093349.1.94074 WP_000093349.1.94080 WP_000093349.1.94082 WP_000093349.1.94087 WP_000093349.1.94093 WP_000093349.1.94096 WP_000093349.1.94119 WP_000093349.1.94122 WP_000093349.1.94123 WP_000093349.1.94130 WP_000093349.1.94165 WP_000093349.1.94172 WP_000093349.1.94182 WP_000093349.1.94229 WP_000093349.1.94242 WP_000093349.1.94245 WP_000093349.1.94248 WP_000093349.1.94268 WP_000093349.1.94287 WP_000093349.1.94293 WP_000093349.1.94294 WP_000093349.1.9430 WP_000093349.1.94320 WP_000093349.1.94335 WP_000093349.1.94337 WP_000093349.1.94340 WP_000093349.1.94341 WP_000093349.1.9437 WP_000093349.1.94374 WP_000093349.1.94375 WP_000093349.1.94376 WP_000093349.1.94389 WP_000093349.1.94407 WP_000093349.1.94414 WP_000093349.1.94423 WP_000093349.1.94484 WP_000093349.1.94505 WP_000093349.1.94530 WP_000093349.1.94536 WP_000093349.1.94550 WP_000093349.1.94576 WP_000093349.1.94625 WP_000093349.1.9464 WP_000093349.1.94688 WP_000093349.1.947 WP_000093349.1.94719 WP_000093349.1.94733 WP_000093349.1.94741 WP_000093349.1.94789 WP_000093349.1.94797 WP_000093349.1.94825 WP_000093349.1.94838 WP_000093349.1.94844 WP_000093349.1.94845 WP_000093349.1.9485 WP_000093349.1.94857 WP_000093349.1.94866 WP_000093349.1.94969 WP_000093349.1.9497 WP_000093349.1.94980 WP_000093349.1.94989 WP_000093349.1.94999 WP_000093349.1.95002 WP_000093349.1.95023 WP_000093349.1.95029 WP_000093349.1.95033 WP_000093349.1.95038 WP_000093349.1.95075 WP_000093349.1.95077 WP_000093349.1.9510 WP_000093349.1.95120 WP_000093349.1.95156 WP_000093349.1.95193 WP_000093349.1.95210 WP_000093349.1.95263 WP_000093349.1.95294 WP_000093349.1.95318 WP_000093349.1.95327 WP_000093349.1.95342 WP_000093349.1.95361 WP_000093349.1.95372 WP_000093349.1.9538 WP_000093349.1.95386 WP_000093349.1.95415 WP_000093349.1.9544 WP_000093349.1.95442 WP_000093349.1.95494 WP_000093349.1.95512 WP_000093349.1.95519 WP_000093349.1.95522 WP_000093349.1.95535 WP_000093349.1.95537 WP_000093349.1.95550 WP_000093349.1.95552 WP_000093349.1.95560 WP_000093349.1.95571 WP_000093349.1.95581 WP_000093349.1.95603 WP_000093349.1.95631 WP_000093349.1.95639 WP_000093349.1.95640 WP_000093349.1.95681 WP_000093349.1.95683 WP_000093349.1.95699 WP_000093349.1.95704 WP_000093349.1.95713 WP_000093349.1.95714 WP_000093349.1.95737 WP_000093349.1.95760 WP_000093349.1.95780 WP_000093349.1.95804 WP_000093349.1.95806 WP_000093349.1.95832 WP_000093349.1.95877 WP_000093349.1.95885 WP_000093349.1.959 WP_000093349.1.95914 WP_000093349.1.95918 WP_000093349.1.95962 WP_000093349.1.95986 WP_000093349.1.95997 WP_000093349.1.96014 WP_000093349.1.96030 WP_000093349.1.96056 WP_000093349.1.96067 WP_000093349.1.96075 WP_000093349.1.96105 WP_000093349.1.96135 WP_000093349.1.96148 WP_000093349.1.96160 WP_000093349.1.96163 WP_000093349.1.96165 WP_000093349.1.9617 WP_000093349.1.96209 WP_000093349.1.96218 WP_000093349.1.96228 WP_000093349.1.96255 WP_000093349.1.96271 WP_000093349.1.96283 WP_000093349.1.96297 WP_000093349.1.96305 WP_000093349.1.96312 WP_000093349.1.96314 WP_000093349.1.96316 WP_000093349.1.96322 WP_000093349.1.96334 WP_000093349.1.96362 WP_000093349.1.96364 WP_000093349.1.96424 WP_000093349.1.96433 WP_000093349.1.96468 WP_000093349.1.96472 WP_000093349.1.96474 WP_000093349.1.96477 WP_000093349.1.96489 WP_000093349.1.9650 WP_000093349.1.96535 WP_000093349.1.96538 WP_000093349.1.96554 WP_000093349.1.96566 WP_000093349.1.96568 WP_000093349.1.96578 WP_000093349.1.96591 WP_000093349.1.96603 WP_000093349.1.96637 WP_000093349.1.96638 WP_000093349.1.96646 WP_000093349.1.96654 WP_000093349.1.96678 WP_000093349.1.96699 WP_000093349.1.96705 WP_000093349.1.96718 WP_000093349.1.96727 WP_000093349.1.9675 WP_000093349.1.96770 WP_000093349.1.96780 WP_000093349.1.96804 WP_000093349.1.96836 WP_000093349.1.96854 WP_000093349.1.96855 WP_000093349.1.96859 WP_000093349.1.96895 WP_000093349.1.96918 WP_000093349.1.96922 WP_000093349.1.9695 WP_000093349.1.96956 WP_000093349.1.96965 WP_000093349.1.96969 WP_000093349.1.96976 WP_000093349.1.96985 WP_000093349.1.96997 WP_000093349.1.97000 WP_000093349.1.97001 WP_000093349.1.97004 WP_000093349.1.97007 WP_000093349.1.97014 WP_000093349.1.97019 WP_000093349.1.97029 WP_000093349.1.97033 WP_000093349.1.97034 WP_000093349.1.97072 WP_000093349.1.97117 WP_000093349.1.97138 WP_000093349.1.97139 WP_000093349.1.97141 WP_000093349.1.97146 WP_000093349.1.97161 WP_000093349.1.97164 WP_000093349.1.97191 WP_000093349.1.97205 WP_000093349.1.97228 WP_000093349.1.97230 WP_000093349.1.97241 WP_000093349.1.97267 WP_000093349.1.97302 WP_000093349.1.97312 WP_000093349.1.97336 WP_000093349.1.97348 WP_000093349.1.97352 WP_000093349.1.97355 WP_000093349.1.97367 WP_000093349.1.9737 WP_000093349.1.97392 WP_000093349.1.97409 WP_000093349.1.97411 WP_000093349.1.97427 WP_000093349.1.9743 WP_000093349.1.97444 WP_000093349.1.97450 WP_000093349.1.97456 WP_000093349.1.97460 WP_000093349.1.97466 WP_000093349.1.97468 WP_000093349.1.9748 WP_000093349.1.97494 WP_000093349.1.97530 WP_000093349.1.97531 WP_000093349.1.97536 WP_000093349.1.97537 WP_000093349.1.97574 WP_000093349.1.97575 WP_000093349.1.97576 WP_000093349.1.9758 WP_000093349.1.97585 WP_000093349.1.97627 WP_000093349.1.97641 WP_000093349.1.97664 WP_000093349.1.97687 WP_000093349.1.97696 WP_000093349.1.97699 WP_000093349.1.97720 WP_000093349.1.97729 WP_000093349.1.97731 WP_000093349.1.97739 WP_000093349.1.97742 WP_000093349.1.97744 WP_000093349.1.97746 WP_000093349.1.97758 WP_000093349.1.97762 WP_000093349.1.97786 WP_000093349.1.97827 WP_000093349.1.97835 WP_000093349.1.9788 WP_000093349.1.9789 WP_000093349.1.97899 WP_000093349.1.97935 WP_000093349.1.97953 WP_000093349.1.97955 WP_000093349.1.97967 WP_000093349.1.97974 WP_000093349.1.97997 WP_000093349.1.98011 WP_000093349.1.98033 WP_000093349.1.98051 WP_000093349.1.98054 WP_000093349.1.98058 WP_000093349.1.98073 WP_000093349.1.98161 WP_000093349.1.98174 WP_000093349.1.98179 WP_000093349.1.98191 WP_000093349.1.98195 WP_000093349.1.98233 WP_000093349.1.98242 WP_000093349.1.98248 WP_000093349.1.98249 WP_000093349.1.98281 WP_000093349.1.98295 WP_000093349.1.98328 WP_000093349.1.98352 WP_000093349.1.98353 WP_000093349.1.98361 WP_000093349.1.98366 WP_000093349.1.98379 WP_000093349.1.98387 WP_000093349.1.98411 WP_000093349.1.98415 WP_000093349.1.98425 WP_000093349.1.98456 WP_000093349.1.98497 WP_000093349.1.98548 WP_000093349.1.98552 WP_000093349.1.98559 WP_000093349.1.98585 WP_000093349.1.986 WP_000093349.1.98609 WP_000093349.1.98655 WP_000093349.1.98659 WP_000093349.1.98667 WP_000093349.1.98706 WP_000093349.1.98710 WP_000093349.1.9872 WP_000093349.1.98723 WP_000093349.1.98730 WP_000093349.1.98734 WP_000093349.1.98741 WP_000093349.1.98750 WP_000093349.1.98767 WP_000093349.1.98786 WP_000093349.1.98797 WP_000093349.1.98805 WP_000093349.1.98807 WP_000093349.1.98821 WP_000093349.1.98837 WP_000093349.1.98842 WP_000093349.1.98858 WP_000093349.1.98874 WP_000093349.1.98880 WP_000093349.1.98894 WP_000093349.1.98912 WP_000093349.1.98967 WP_000093349.1.98978 WP_000093349.1.98981 WP_000093349.1.98985 WP_000093349.1.99009 WP_000093349.1.99027 WP_000093349.1.99081 WP_000093349.1.991 WP_000093349.1.9910 WP_000093349.1.99136 WP_000093349.1.99155 WP_000093349.1.99171 WP_000093349.1.99174 WP_000093349.1.99207 WP_000093349.1.99217 WP_000093349.1.99228 WP_000093349.1.99249 WP_000093349.1.99280 WP_000093349.1.99283 WP_000093349.1.99308 WP_000093349.1.99331 WP_000093349.1.99359 WP_000093349.1.9936 WP_000093349.1.99405 WP_000093349.1.99414 WP_000093349.1.99418 WP_000093349.1.99430 WP_000093349.1.99492 WP_000093349.1.99494 WP_000093349.1.99509 WP_000093349.1.99519 WP_000093349.1.99523 WP_000093349.1.99536 WP_000093349.1.99538 WP_000093349.1.99564 WP_000093349.1.99569 WP_000093349.1.9960 WP_000093349.1.99631 WP_000093349.1.99638 WP_000093349.1.9965 WP_000093349.1.99683 WP_000093349.1.99686 WP_000093349.1.9974 WP_000093349.1.99802 WP_000093349.1.99830 WP_000093349.1.99849 WP_000093349.1.99850 WP_000093349.1.99859 WP_000093349.1.99860 WP_000093349.1.9987 WP_000093349.1.99888 WP_000093349.1.99926 WP_000093349.1.99954 WP_000093349.1.99956 WP_000093349.1.99979 WP_000093349.1.99984 WP_000093349.1.99985 WP_000093349.1.99999 YP_500147.1.76163 gi|161509765|ref|YP_001575424.1| gi|379021319|ref|YP_005297981.1| gi|479329548|ref|YP_007868607.1| gi|470193373|ref|YP_007579726.1| gi|156979855|ref|YP_001442114.1| gi|404478887|ref|YP_006710317.1| gi|15924527|ref|NP_372061.1| gi|387602877|ref|YP_005734398.1| 158878.SAV1537 158879.SA1367 196620.MW1489 282459.SAS1475 359786.SaurJH9_1595 359787.SaurJH1_1628 418127.SAHV_1524 426430.NWMN_1441 451515.SAUSA300_1498 451516.USA300HOU_1538 681288.SAAV_1529 93061.SAOUHSC_01634 93062.SACOL1595 gi|470199272|ref|YP_007585672.1| gi|88195343|ref|YP_500147.1| gi|470191408|ref|YP_007577718.1| gi|386729237|ref|YP_006195620.1| gi|87160187|ref|YP_494193.1| gi|384864759|ref|YP_005750118.1| jgi|Aspzo1|68343|e_gw1.9.496.1 gi|57651931|ref|YP_186435.1| gi|470222862|ref|YP_007621419.1| gi|470224829|ref|YP_007623408.1| gi|150394088|ref|YP_001316763.1| gi|470197304|ref|YP_007583705.1| gi|49486373|ref|YP_043594.1| gi|148268021|ref|YP_001246964.1| gi|269203166|ref|YP_003282435.1| gi|545637875|ref|YP_008588051.1| gi|387150680|ref|YP_005742244.1| gi|470195339|ref|YP_007581691.1| gi|545635016|ref|YP_008585586.1| gi|15927117|ref|NP_374650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]