SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150394310|ref|YP_001316985.1| from Staphylococcus aureus subsp. aureus JH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150394310|ref|YP_001316985.1|
Domain Number 1 Region: 36-303
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.32e-68
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150394310|ref|YP_001316985.1|
Sequence length 333
Comment proline dehydrogenase [Staphylococcus aureus subsp. aureus JH1]
Sequence
MALLKNFFIGLSNNSFLNNAAKKVGPRLGANKVVAGNTIPELINTIEYLNDKNIAVTVDN
LGEFVGTVEESNHAKEQILTIMDALHQHGVKAHMSVKLSQLGAEFDLELAYQNLREILLK
ANTYNNMHINIDTEKYASLQQIVQVLDRLKGEFRNVGTVIQAYLYDSHKLVDKYQDLRLR
LVKGAYKENESIAFQSKEDVDANYIKIIEQRLLNARNFTSIATHDHRIINHVKQFMKENH
IEKDRMEFQMLYGFRSELAEEIANEGYNFTIYVPYGDDWFAYFMRRLAERPQNLSLAVKE
FVKPAGLKRVGIIAALGATVMLGLSTIKKLCRK
Download sequence
Identical sequences A0A0H3JLE9 A0A0H3JSU5 A0A1Q4H3C0
gi|470195520|ref|YP_007581872.1| gi|470225010|ref|YP_007623589.1| gi|269203403|ref|YP_003282672.1| gi|470191589|ref|YP_007577899.1| gi|150394310|ref|YP_001316985.1| gi|387150907|ref|YP_005742471.1| gi|384864975|ref|YP_005750334.1| gi|470223043|ref|YP_007621600.1| gi|470193554|ref|YP_007579907.1| WP_001196362.1.10014 WP_001196362.1.100171 WP_001196362.1.100184 WP_001196362.1.100235 WP_001196362.1.10032 WP_001196362.1.100366 WP_001196362.1.100399 WP_001196362.1.10046 WP_001196362.1.100464 WP_001196362.1.10050 WP_001196362.1.100535 WP_001196362.1.100562 WP_001196362.1.100582 WP_001196362.1.100596 WP_001196362.1.100693 WP_001196362.1.100699 WP_001196362.1.100704 WP_001196362.1.100719 WP_001196362.1.100823 WP_001196362.1.100832 WP_001196362.1.100860 WP_001196362.1.100888 WP_001196362.1.100934 WP_001196362.1.10097 WP_001196362.1.101002 WP_001196362.1.101019 WP_001196362.1.101027 WP_001196362.1.101068 WP_001196362.1.101071 WP_001196362.1.101072 WP_001196362.1.101103 WP_001196362.1.10111 WP_001196362.1.101160 WP_001196362.1.101192 WP_001196362.1.101262 WP_001196362.1.101379 WP_001196362.1.101414 WP_001196362.1.101440 WP_001196362.1.101441 WP_001196362.1.10148 WP_001196362.1.101567 WP_001196362.1.10165 WP_001196362.1.101661 WP_001196362.1.101691 WP_001196362.1.101704 WP_001196362.1.101728 WP_001196362.1.101745 WP_001196362.1.101778 WP_001196362.1.101813 WP_001196362.1.101820 WP_001196362.1.101825 WP_001196362.1.101852 WP_001196362.1.101902 WP_001196362.1.101906 WP_001196362.1.101943 WP_001196362.1.102065 WP_001196362.1.102096 WP_001196362.1.102123 WP_001196362.1.102130 WP_001196362.1.102132 WP_001196362.1.10238 WP_001196362.1.1025 WP_001196362.1.10274 WP_001196362.1.1031 WP_001196362.1.10343 WP_001196362.1.1043 WP_001196362.1.10436 WP_001196362.1.10478 WP_001196362.1.10481 WP_001196362.1.10526 WP_001196362.1.10624 WP_001196362.1.10749 WP_001196362.1.10751 WP_001196362.1.1077 WP_001196362.1.10823 WP_001196362.1.10858 WP_001196362.1.10919 WP_001196362.1.10942 WP_001196362.1.10976 WP_001196362.1.10979 WP_001196362.1.11001 WP_001196362.1.11069 WP_001196362.1.11083 WP_001196362.1.11084 WP_001196362.1.1115 WP_001196362.1.11162 WP_001196362.1.11220 WP_001196362.1.11261 WP_001196362.1.11282 WP_001196362.1.11286 WP_001196362.1.11322 WP_001196362.1.11333 WP_001196362.1.11378 WP_001196362.1.11403 WP_001196362.1.11447 WP_001196362.1.11451 WP_001196362.1.1147 WP_001196362.1.11504 WP_001196362.1.11513 WP_001196362.1.11556 WP_001196362.1.11611 WP_001196362.1.11640 WP_001196362.1.11646 WP_001196362.1.11663 WP_001196362.1.1171 WP_001196362.1.11730 WP_001196362.1.11736 WP_001196362.1.11768 WP_001196362.1.11794 WP_001196362.1.11837 WP_001196362.1.11884 WP_001196362.1.11903 WP_001196362.1.12019 WP_001196362.1.12042 WP_001196362.1.1210 WP_001196362.1.12149 WP_001196362.1.12152 WP_001196362.1.12170 WP_001196362.1.12175 WP_001196362.1.12234 WP_001196362.1.12256 WP_001196362.1.12330 WP_001196362.1.12437 WP_001196362.1.12508 WP_001196362.1.1257 WP_001196362.1.12598 WP_001196362.1.12608 WP_001196362.1.12618 WP_001196362.1.12685 WP_001196362.1.12733 WP_001196362.1.12737 WP_001196362.1.12770 WP_001196362.1.12780 WP_001196362.1.12788 WP_001196362.1.12829 WP_001196362.1.12858 WP_001196362.1.12884 WP_001196362.1.12904 WP_001196362.1.12918 WP_001196362.1.12920 WP_001196362.1.13013 WP_001196362.1.13062 WP_001196362.1.13154 WP_001196362.1.13169 WP_001196362.1.13189 WP_001196362.1.13243 WP_001196362.1.13250 WP_001196362.1.13326 WP_001196362.1.13355 WP_001196362.1.13379 WP_001196362.1.13405 WP_001196362.1.13448 WP_001196362.1.13514 WP_001196362.1.13554 WP_001196362.1.13612 WP_001196362.1.13665 WP_001196362.1.13668 WP_001196362.1.13670 WP_001196362.1.13879 WP_001196362.1.13897 WP_001196362.1.13933 WP_001196362.1.13986 WP_001196362.1.13987 WP_001196362.1.14025 WP_001196362.1.14097 WP_001196362.1.14143 WP_001196362.1.14163 WP_001196362.1.1420 WP_001196362.1.14201 WP_001196362.1.1425 WP_001196362.1.1429 WP_001196362.1.14305 WP_001196362.1.14342 WP_001196362.1.14358 WP_001196362.1.14397 WP_001196362.1.14412 WP_001196362.1.14535 WP_001196362.1.14577 WP_001196362.1.14596 WP_001196362.1.14639 WP_001196362.1.14696 WP_001196362.1.1471 WP_001196362.1.14729 WP_001196362.1.14734 WP_001196362.1.14774 WP_001196362.1.14825 WP_001196362.1.14846 WP_001196362.1.14874 WP_001196362.1.14967 WP_001196362.1.14970 WP_001196362.1.15015 WP_001196362.1.15029 WP_001196362.1.15108 WP_001196362.1.15173 WP_001196362.1.15185 WP_001196362.1.1520 WP_001196362.1.15201 WP_001196362.1.1525 WP_001196362.1.15268 WP_001196362.1.15269 WP_001196362.1.15294 WP_001196362.1.15296 WP_001196362.1.15421 WP_001196362.1.15533 WP_001196362.1.15544 WP_001196362.1.15546 WP_001196362.1.1558 WP_001196362.1.15590 WP_001196362.1.1564 WP_001196362.1.15691 WP_001196362.1.15722 WP_001196362.1.15785 WP_001196362.1.15812 WP_001196362.1.159 WP_001196362.1.15920 WP_001196362.1.15921 WP_001196362.1.15925 WP_001196362.1.16018 WP_001196362.1.16068 WP_001196362.1.16096 WP_001196362.1.16098 WP_001196362.1.16140 WP_001196362.1.16173 WP_001196362.1.16195 WP_001196362.1.16203 WP_001196362.1.16223 WP_001196362.1.1623 WP_001196362.1.16251 WP_001196362.1.16265 WP_001196362.1.16276 WP_001196362.1.16311 WP_001196362.1.16395 WP_001196362.1.16407 WP_001196362.1.16458 WP_001196362.1.16589 WP_001196362.1.16632 WP_001196362.1.16639 WP_001196362.1.1665 WP_001196362.1.16651 WP_001196362.1.16653 WP_001196362.1.16693 WP_001196362.1.16747 WP_001196362.1.16761 WP_001196362.1.16794 WP_001196362.1.16815 WP_001196362.1.16824 WP_001196362.1.16880 WP_001196362.1.16882 WP_001196362.1.16920 WP_001196362.1.16925 WP_001196362.1.16969 WP_001196362.1.17046 WP_001196362.1.17080 WP_001196362.1.17122 WP_001196362.1.17132 WP_001196362.1.17139 WP_001196362.1.17157 WP_001196362.1.17180 WP_001196362.1.17240 WP_001196362.1.1729 WP_001196362.1.17309 WP_001196362.1.17327 WP_001196362.1.1736 WP_001196362.1.1741 WP_001196362.1.17419 WP_001196362.1.17454 WP_001196362.1.17529 WP_001196362.1.17531 WP_001196362.1.1756 WP_001196362.1.17590 WP_001196362.1.17643 WP_001196362.1.1765 WP_001196362.1.17671 WP_001196362.1.17717 WP_001196362.1.17718 WP_001196362.1.17725 WP_001196362.1.17737 WP_001196362.1.17796 WP_001196362.1.17818 WP_001196362.1.17832 WP_001196362.1.17847 WP_001196362.1.17853 WP_001196362.1.17909 WP_001196362.1.17922 WP_001196362.1.17943 WP_001196362.1.17987 WP_001196362.1.18011 WP_001196362.1.18069 WP_001196362.1.18080 WP_001196362.1.18113 WP_001196362.1.18140 WP_001196362.1.18153 WP_001196362.1.18203 WP_001196362.1.18237 WP_001196362.1.18248 WP_001196362.1.18261 WP_001196362.1.18288 WP_001196362.1.1829 WP_001196362.1.18301 WP_001196362.1.18309 WP_001196362.1.18310 WP_001196362.1.18360 WP_001196362.1.18412 WP_001196362.1.18429 WP_001196362.1.1847 WP_001196362.1.18487 WP_001196362.1.18506 WP_001196362.1.18507 WP_001196362.1.18539 WP_001196362.1.18560 WP_001196362.1.18570 WP_001196362.1.18591 WP_001196362.1.18632 WP_001196362.1.18679 WP_001196362.1.18741 WP_001196362.1.18777 WP_001196362.1.18792 WP_001196362.1.18818 WP_001196362.1.18819 WP_001196362.1.18834 WP_001196362.1.18882 WP_001196362.1.1892 WP_001196362.1.18965 WP_001196362.1.18974 WP_001196362.1.18996 WP_001196362.1.19052 WP_001196362.1.19082 WP_001196362.1.1911 WP_001196362.1.19301 WP_001196362.1.19322 WP_001196362.1.19430 WP_001196362.1.19450 WP_001196362.1.19537 WP_001196362.1.19555 WP_001196362.1.19577 WP_001196362.1.19611 WP_001196362.1.1964 WP_001196362.1.19643 WP_001196362.1.19701 WP_001196362.1.19725 WP_001196362.1.19732 WP_001196362.1.1974 WP_001196362.1.19748 WP_001196362.1.19792 WP_001196362.1.19816 WP_001196362.1.19848 WP_001196362.1.19891 WP_001196362.1.19912 WP_001196362.1.19921 WP_001196362.1.19980 WP_001196362.1.19981 WP_001196362.1.19982 WP_001196362.1.20006 WP_001196362.1.20049 WP_001196362.1.20052 WP_001196362.1.2007 WP_001196362.1.20078 WP_001196362.1.2008 WP_001196362.1.20090 WP_001196362.1.20100 WP_001196362.1.20156 WP_001196362.1.20161 WP_001196362.1.20167 WP_001196362.1.20191 WP_001196362.1.20245 WP_001196362.1.2029 WP_001196362.1.20324 WP_001196362.1.20340 WP_001196362.1.20394 WP_001196362.1.20398 WP_001196362.1.20399 WP_001196362.1.20411 WP_001196362.1.20447 WP_001196362.1.20479 WP_001196362.1.20487 WP_001196362.1.20574 WP_001196362.1.20579 WP_001196362.1.20585 WP_001196362.1.20611 WP_001196362.1.20619 WP_001196362.1.20620 WP_001196362.1.20736 WP_001196362.1.20796 WP_001196362.1.20821 WP_001196362.1.20846 WP_001196362.1.20867 WP_001196362.1.20878 WP_001196362.1.20913 WP_001196362.1.20922 WP_001196362.1.20935 WP_001196362.1.20939 WP_001196362.1.20945 WP_001196362.1.20971 WP_001196362.1.21009 WP_001196362.1.21056 WP_001196362.1.21066 WP_001196362.1.21078 WP_001196362.1.21109 WP_001196362.1.21111 WP_001196362.1.21154 WP_001196362.1.21183 WP_001196362.1.2119 WP_001196362.1.21257 WP_001196362.1.21272 WP_001196362.1.21339 WP_001196362.1.2135 WP_001196362.1.21359 WP_001196362.1.21379 WP_001196362.1.21393 WP_001196362.1.21412 WP_001196362.1.21449 WP_001196362.1.21464 WP_001196362.1.21480 WP_001196362.1.21500 WP_001196362.1.21514 WP_001196362.1.21572 WP_001196362.1.2159 WP_001196362.1.2160 WP_001196362.1.21636 WP_001196362.1.21724 WP_001196362.1.21746 WP_001196362.1.21763 WP_001196362.1.21787 WP_001196362.1.21830 WP_001196362.1.21988 WP_001196362.1.22027 WP_001196362.1.22082 WP_001196362.1.22111 WP_001196362.1.22177 WP_001196362.1.22197 WP_001196362.1.22227 WP_001196362.1.22302 WP_001196362.1.22400 WP_001196362.1.22493 WP_001196362.1.22533 WP_001196362.1.22559 WP_001196362.1.22650 WP_001196362.1.22696 WP_001196362.1.22702 WP_001196362.1.22709 WP_001196362.1.22738 WP_001196362.1.22789 WP_001196362.1.22790 WP_001196362.1.22792 WP_001196362.1.22803 WP_001196362.1.22853 WP_001196362.1.22869 WP_001196362.1.22890 WP_001196362.1.22969 WP_001196362.1.23008 WP_001196362.1.23061 WP_001196362.1.23082 WP_001196362.1.23103 WP_001196362.1.23121 WP_001196362.1.23130 WP_001196362.1.23132 WP_001196362.1.23133 WP_001196362.1.23161 WP_001196362.1.23185 WP_001196362.1.23244 WP_001196362.1.2327 WP_001196362.1.23275 WP_001196362.1.23288 WP_001196362.1.23413 WP_001196362.1.23449 WP_001196362.1.23531 WP_001196362.1.23572 WP_001196362.1.23630 WP_001196362.1.23644 WP_001196362.1.23690 WP_001196362.1.23740 WP_001196362.1.23796 WP_001196362.1.23809 WP_001196362.1.23842 WP_001196362.1.2389 WP_001196362.1.23900 WP_001196362.1.23956 WP_001196362.1.23972 WP_001196362.1.23995 WP_001196362.1.24000 WP_001196362.1.24129 WP_001196362.1.24174 WP_001196362.1.24207 WP_001196362.1.24213 WP_001196362.1.24263 WP_001196362.1.2427 WP_001196362.1.24277 WP_001196362.1.24343 WP_001196362.1.24416 WP_001196362.1.24437 WP_001196362.1.24469 WP_001196362.1.2450 WP_001196362.1.24589 WP_001196362.1.24596 WP_001196362.1.24602 WP_001196362.1.24631 WP_001196362.1.24679 WP_001196362.1.24823 WP_001196362.1.24855 WP_001196362.1.2497 WP_001196362.1.25007 WP_001196362.1.2501 WP_001196362.1.25012 WP_001196362.1.2506 WP_001196362.1.25070 WP_001196362.1.25092 WP_001196362.1.25098 WP_001196362.1.25115 WP_001196362.1.25145 WP_001196362.1.25167 WP_001196362.1.25209 WP_001196362.1.25287 WP_001196362.1.25361 WP_001196362.1.25459 WP_001196362.1.25489 WP_001196362.1.2552 WP_001196362.1.25557 WP_001196362.1.25595 WP_001196362.1.25621 WP_001196362.1.25623 WP_001196362.1.25721 WP_001196362.1.25758 WP_001196362.1.25772 WP_001196362.1.25779 WP_001196362.1.25802 WP_001196362.1.25840 WP_001196362.1.25856 WP_001196362.1.25857 WP_001196362.1.2590 WP_001196362.1.25910 WP_001196362.1.25930 WP_001196362.1.26039 WP_001196362.1.2608 WP_001196362.1.26086 WP_001196362.1.26106 WP_001196362.1.26143 WP_001196362.1.26169 WP_001196362.1.2621 WP_001196362.1.26255 WP_001196362.1.26266 WP_001196362.1.26276 WP_001196362.1.26290 WP_001196362.1.26298 WP_001196362.1.26314 WP_001196362.1.26318 WP_001196362.1.26340 WP_001196362.1.26345 WP_001196362.1.26354 WP_001196362.1.26359 WP_001196362.1.26364 WP_001196362.1.26399 WP_001196362.1.26404 WP_001196362.1.2643 WP_001196362.1.26506 WP_001196362.1.26662 WP_001196362.1.26677 WP_001196362.1.26692 WP_001196362.1.2673 WP_001196362.1.26751 WP_001196362.1.26772 WP_001196362.1.26804 WP_001196362.1.2684 WP_001196362.1.26840 WP_001196362.1.26865 WP_001196362.1.26884 WP_001196362.1.2689 WP_001196362.1.26905 WP_001196362.1.26938 WP_001196362.1.26944 WP_001196362.1.27013 WP_001196362.1.27053 WP_001196362.1.27083 WP_001196362.1.27166 WP_001196362.1.27170 WP_001196362.1.27182 WP_001196362.1.2719 WP_001196362.1.27262 WP_001196362.1.27293 WP_001196362.1.27294 WP_001196362.1.27323 WP_001196362.1.27387 WP_001196362.1.27447 WP_001196362.1.27456 WP_001196362.1.27468 WP_001196362.1.2753 WP_001196362.1.27539 WP_001196362.1.27590 WP_001196362.1.27628 WP_001196362.1.27646 WP_001196362.1.27689 WP_001196362.1.27739 WP_001196362.1.27744 WP_001196362.1.27765 WP_001196362.1.27793 WP_001196362.1.27830 WP_001196362.1.2795 WP_001196362.1.28016 WP_001196362.1.28091 WP_001196362.1.28105 WP_001196362.1.28173 WP_001196362.1.28226 WP_001196362.1.28230 WP_001196362.1.28253 WP_001196362.1.28257 WP_001196362.1.28274 WP_001196362.1.28315 WP_001196362.1.28319 WP_001196362.1.28347 WP_001196362.1.28400 WP_001196362.1.28430 WP_001196362.1.2852 WP_001196362.1.28578 WP_001196362.1.28580 WP_001196362.1.28605 WP_001196362.1.28652 WP_001196362.1.28720 WP_001196362.1.28763 WP_001196362.1.28784 WP_001196362.1.28785 WP_001196362.1.28848 WP_001196362.1.28871 WP_001196362.1.28909 WP_001196362.1.28981 WP_001196362.1.28987 WP_001196362.1.29052 WP_001196362.1.29060 WP_001196362.1.29112 WP_001196362.1.29155 WP_001196362.1.29166 WP_001196362.1.29187 WP_001196362.1.29242 WP_001196362.1.29263 WP_001196362.1.29276 WP_001196362.1.29329 WP_001196362.1.29366 WP_001196362.1.29368 WP_001196362.1.29395 WP_001196362.1.29420 WP_001196362.1.29468 WP_001196362.1.29522 WP_001196362.1.2957 WP_001196362.1.2972 WP_001196362.1.29736 WP_001196362.1.29744 WP_001196362.1.29788 WP_001196362.1.2981 WP_001196362.1.29862 WP_001196362.1.29902 WP_001196362.1.29905 WP_001196362.1.29918 WP_001196362.1.29981 WP_001196362.1.30051 WP_001196362.1.30089 WP_001196362.1.30095 WP_001196362.1.30100 WP_001196362.1.30152 WP_001196362.1.30197 WP_001196362.1.30204 WP_001196362.1.30249 WP_001196362.1.30268 WP_001196362.1.30302 WP_001196362.1.30307 WP_001196362.1.30328 WP_001196362.1.30364 WP_001196362.1.30508 WP_001196362.1.30560 WP_001196362.1.30622 WP_001196362.1.30646 WP_001196362.1.30666 WP_001196362.1.30702 WP_001196362.1.30720 WP_001196362.1.30726 WP_001196362.1.30763 WP_001196362.1.3077 WP_001196362.1.30845 WP_001196362.1.30847 WP_001196362.1.30854 WP_001196362.1.31005 WP_001196362.1.31022 WP_001196362.1.31039 WP_001196362.1.31048 WP_001196362.1.31091 WP_001196362.1.31176 WP_001196362.1.31206 WP_001196362.1.3123 WP_001196362.1.31315 WP_001196362.1.31337 WP_001196362.1.31339 WP_001196362.1.31355 WP_001196362.1.31437 WP_001196362.1.31442 WP_001196362.1.31468 WP_001196362.1.31479 WP_001196362.1.31529 WP_001196362.1.31539 WP_001196362.1.31642 WP_001196362.1.31647 WP_001196362.1.31653 WP_001196362.1.31686 WP_001196362.1.31753 WP_001196362.1.31827 WP_001196362.1.31828 WP_001196362.1.31842 WP_001196362.1.31892 WP_001196362.1.31931 WP_001196362.1.31997 WP_001196362.1.32003 WP_001196362.1.32005 WP_001196362.1.32029 WP_001196362.1.32067 WP_001196362.1.32160 WP_001196362.1.32207 WP_001196362.1.3229 WP_001196362.1.32339 WP_001196362.1.3242 WP_001196362.1.32474 WP_001196362.1.32481 WP_001196362.1.32483 WP_001196362.1.32514 WP_001196362.1.32534 WP_001196362.1.32565 WP_001196362.1.32607 WP_001196362.1.32634 WP_001196362.1.32645 WP_001196362.1.32746 WP_001196362.1.32764 WP_001196362.1.32770 WP_001196362.1.32800 WP_001196362.1.32928 WP_001196362.1.32939 WP_001196362.1.32954 WP_001196362.1.33038 WP_001196362.1.33048 WP_001196362.1.33110 WP_001196362.1.33123 WP_001196362.1.33138 WP_001196362.1.33212 WP_001196362.1.33250 WP_001196362.1.33266 WP_001196362.1.33296 WP_001196362.1.33335 WP_001196362.1.33357 WP_001196362.1.33416 WP_001196362.1.3342 WP_001196362.1.33432 WP_001196362.1.33468 WP_001196362.1.3347 WP_001196362.1.33507 WP_001196362.1.33594 WP_001196362.1.33626 WP_001196362.1.33627 WP_001196362.1.3363 WP_001196362.1.33654 WP_001196362.1.33692 WP_001196362.1.33695 WP_001196362.1.33718 WP_001196362.1.33735 WP_001196362.1.33743 WP_001196362.1.33769 WP_001196362.1.33792 WP_001196362.1.33804 WP_001196362.1.33813 WP_001196362.1.33968 WP_001196362.1.33971 WP_001196362.1.33983 WP_001196362.1.34026 WP_001196362.1.34030 WP_001196362.1.34051 WP_001196362.1.34062 WP_001196362.1.34100 WP_001196362.1.34132 WP_001196362.1.34182 WP_001196362.1.34209 WP_001196362.1.34244 WP_001196362.1.34250 WP_001196362.1.34251 WP_001196362.1.34285 WP_001196362.1.34381 WP_001196362.1.34403 WP_001196362.1.34410 WP_001196362.1.34482 WP_001196362.1.34492 WP_001196362.1.34502 WP_001196362.1.34510 WP_001196362.1.34526 WP_001196362.1.3461 WP_001196362.1.34677 WP_001196362.1.34737 WP_001196362.1.34767 WP_001196362.1.34818 WP_001196362.1.34890 WP_001196362.1.34918 WP_001196362.1.34998 WP_001196362.1.35059 WP_001196362.1.35062 WP_001196362.1.35089 WP_001196362.1.35097 WP_001196362.1.35110 WP_001196362.1.35121 WP_001196362.1.35233 WP_001196362.1.35276 WP_001196362.1.35285 WP_001196362.1.35297 WP_001196362.1.35334 WP_001196362.1.35342 WP_001196362.1.354 WP_001196362.1.35415 WP_001196362.1.3547 WP_001196362.1.35498 WP_001196362.1.35525 WP_001196362.1.35615 WP_001196362.1.35623 WP_001196362.1.35673 WP_001196362.1.3569 WP_001196362.1.35801 WP_001196362.1.35826 WP_001196362.1.35900 WP_001196362.1.35928 WP_001196362.1.35950 WP_001196362.1.36004 WP_001196362.1.36082 WP_001196362.1.36102 WP_001196362.1.36119 WP_001196362.1.36141 WP_001196362.1.3617 WP_001196362.1.36176 WP_001196362.1.36187 WP_001196362.1.36188 WP_001196362.1.36250 WP_001196362.1.36264 WP_001196362.1.36278 WP_001196362.1.36282 WP_001196362.1.36307 WP_001196362.1.36344 WP_001196362.1.36389 WP_001196362.1.36532 WP_001196362.1.36535 WP_001196362.1.3655 WP_001196362.1.36570 WP_001196362.1.36580 WP_001196362.1.36600 WP_001196362.1.36615 WP_001196362.1.36646 WP_001196362.1.3666 WP_001196362.1.36689 WP_001196362.1.36697 WP_001196362.1.36745 WP_001196362.1.3675 WP_001196362.1.36783 WP_001196362.1.36796 WP_001196362.1.36822 WP_001196362.1.3685 WP_001196362.1.36858 WP_001196362.1.3687 WP_001196362.1.36955 WP_001196362.1.36979 WP_001196362.1.36980 WP_001196362.1.36997 WP_001196362.1.37002 WP_001196362.1.37016 WP_001196362.1.3703 WP_001196362.1.37044 WP_001196362.1.37055 WP_001196362.1.37080 WP_001196362.1.37121 WP_001196362.1.37134 WP_001196362.1.37220 WP_001196362.1.37341 WP_001196362.1.37398 WP_001196362.1.37424 WP_001196362.1.37467 WP_001196362.1.37583 WP_001196362.1.37602 WP_001196362.1.37605 WP_001196362.1.37606 WP_001196362.1.37621 WP_001196362.1.37624 WP_001196362.1.3776 WP_001196362.1.37781 WP_001196362.1.37815 WP_001196362.1.37828 WP_001196362.1.37953 WP_001196362.1.37987 WP_001196362.1.38038 WP_001196362.1.38057 WP_001196362.1.38070 WP_001196362.1.38082 WP_001196362.1.3809 WP_001196362.1.38160 WP_001196362.1.38177 WP_001196362.1.3820 WP_001196362.1.38230 WP_001196362.1.38232 WP_001196362.1.38276 WP_001196362.1.38282 WP_001196362.1.38309 WP_001196362.1.38339 WP_001196362.1.38383 WP_001196362.1.3842 WP_001196362.1.38437 WP_001196362.1.38453 WP_001196362.1.38493 WP_001196362.1.38522 WP_001196362.1.38546 WP_001196362.1.38607 WP_001196362.1.38612 WP_001196362.1.3867 WP_001196362.1.38674 WP_001196362.1.38721 WP_001196362.1.38760 WP_001196362.1.38823 WP_001196362.1.38841 WP_001196362.1.38858 WP_001196362.1.38926 WP_001196362.1.38931 WP_001196362.1.38940 WP_001196362.1.38941 WP_001196362.1.38972 WP_001196362.1.38989 WP_001196362.1.390 WP_001196362.1.39012 WP_001196362.1.39014 WP_001196362.1.39043 WP_001196362.1.39053 WP_001196362.1.3906 WP_001196362.1.391 WP_001196362.1.39108 WP_001196362.1.39203 WP_001196362.1.39206 WP_001196362.1.39217 WP_001196362.1.3926 WP_001196362.1.39272 WP_001196362.1.39290 WP_001196362.1.39332 WP_001196362.1.39333 WP_001196362.1.39397 WP_001196362.1.39406 WP_001196362.1.39486 WP_001196362.1.39506 WP_001196362.1.39550 WP_001196362.1.39645 WP_001196362.1.39687 WP_001196362.1.39689 WP_001196362.1.39697 WP_001196362.1.39711 WP_001196362.1.39738 WP_001196362.1.39767 WP_001196362.1.39789 WP_001196362.1.39832 WP_001196362.1.39838 WP_001196362.1.39856 WP_001196362.1.39869 WP_001196362.1.40014 WP_001196362.1.40043 WP_001196362.1.40099 WP_001196362.1.40120 WP_001196362.1.40137 WP_001196362.1.4015 WP_001196362.1.40164 WP_001196362.1.40173 WP_001196362.1.4019 WP_001196362.1.40318 WP_001196362.1.40320 WP_001196362.1.40330 WP_001196362.1.40342 WP_001196362.1.40368 WP_001196362.1.40406 WP_001196362.1.4045 WP_001196362.1.40474 WP_001196362.1.40481 WP_001196362.1.40505 WP_001196362.1.40531 WP_001196362.1.40532 WP_001196362.1.4056 WP_001196362.1.40579 WP_001196362.1.40588 WP_001196362.1.40620 WP_001196362.1.40644 WP_001196362.1.40655 WP_001196362.1.40658 WP_001196362.1.40659 WP_001196362.1.40760 WP_001196362.1.40797 WP_001196362.1.40816 WP_001196362.1.41064 WP_001196362.1.41084 WP_001196362.1.41094 WP_001196362.1.41119 WP_001196362.1.41129 WP_001196362.1.4115 WP_001196362.1.41178 WP_001196362.1.41208 WP_001196362.1.41241 WP_001196362.1.41255 WP_001196362.1.41289 WP_001196362.1.4129 WP_001196362.1.41426 WP_001196362.1.41432 WP_001196362.1.41433 WP_001196362.1.41499 WP_001196362.1.41558 WP_001196362.1.41567 WP_001196362.1.41582 WP_001196362.1.41674 WP_001196362.1.41839 WP_001196362.1.4188 WP_001196362.1.41935 WP_001196362.1.41943 WP_001196362.1.41989 WP_001196362.1.420 WP_001196362.1.42015 WP_001196362.1.42017 WP_001196362.1.42028 WP_001196362.1.42087 WP_001196362.1.42125 WP_001196362.1.42137 WP_001196362.1.42198 WP_001196362.1.42269 WP_001196362.1.42305 WP_001196362.1.42355 WP_001196362.1.42403 WP_001196362.1.42436 WP_001196362.1.42459 WP_001196362.1.42481 WP_001196362.1.42510 WP_001196362.1.42593 WP_001196362.1.426 WP_001196362.1.42640 WP_001196362.1.42652 WP_001196362.1.42668 WP_001196362.1.42674 WP_001196362.1.42737 WP_001196362.1.42759 WP_001196362.1.42786 WP_001196362.1.42837 WP_001196362.1.4293 WP_001196362.1.4299 WP_001196362.1.43014 WP_001196362.1.43047 WP_001196362.1.43072 WP_001196362.1.43122 WP_001196362.1.43131 WP_001196362.1.43134 WP_001196362.1.43143 WP_001196362.1.43147 WP_001196362.1.43159 WP_001196362.1.43165 WP_001196362.1.43202 WP_001196362.1.43232 WP_001196362.1.43248 WP_001196362.1.4325 WP_001196362.1.43263 WP_001196362.1.4327 WP_001196362.1.43323 WP_001196362.1.43341 WP_001196362.1.43349 WP_001196362.1.43369 WP_001196362.1.4337 WP_001196362.1.43406 WP_001196362.1.43460 WP_001196362.1.4347 WP_001196362.1.43550 WP_001196362.1.43560 WP_001196362.1.43617 WP_001196362.1.43618 WP_001196362.1.43627 WP_001196362.1.43659 WP_001196362.1.43670 WP_001196362.1.43702 WP_001196362.1.43703 WP_001196362.1.4372 WP_001196362.1.43731 WP_001196362.1.43752 WP_001196362.1.43788 WP_001196362.1.43819 WP_001196362.1.43827 WP_001196362.1.4385 WP_001196362.1.43904 WP_001196362.1.43915 WP_001196362.1.44119 WP_001196362.1.44153 WP_001196362.1.44181 WP_001196362.1.44195 WP_001196362.1.44265 WP_001196362.1.44302 WP_001196362.1.44388 WP_001196362.1.44396 WP_001196362.1.44405 WP_001196362.1.44420 WP_001196362.1.44579 WP_001196362.1.44588 WP_001196362.1.44605 WP_001196362.1.44631 WP_001196362.1.44672 WP_001196362.1.44732 WP_001196362.1.44755 WP_001196362.1.44785 WP_001196362.1.44788 WP_001196362.1.44796 WP_001196362.1.44881 WP_001196362.1.44882 WP_001196362.1.44914 WP_001196362.1.44955 WP_001196362.1.44969 WP_001196362.1.45033 WP_001196362.1.45035 WP_001196362.1.45099 WP_001196362.1.4513 WP_001196362.1.45133 WP_001196362.1.45164 WP_001196362.1.45170 WP_001196362.1.45272 WP_001196362.1.45290 WP_001196362.1.45297 WP_001196362.1.453 WP_001196362.1.45364 WP_001196362.1.45431 WP_001196362.1.45439 WP_001196362.1.45472 WP_001196362.1.4550 WP_001196362.1.45507 WP_001196362.1.45560 WP_001196362.1.45577 WP_001196362.1.45670 WP_001196362.1.45703 WP_001196362.1.45730 WP_001196362.1.45771 WP_001196362.1.45780 WP_001196362.1.4584 WP_001196362.1.45852 WP_001196362.1.45897 WP_001196362.1.45954 WP_001196362.1.4598 WP_001196362.1.46003 WP_001196362.1.46005 WP_001196362.1.46055 WP_001196362.1.46087 WP_001196362.1.46168 WP_001196362.1.46208 WP_001196362.1.46222 WP_001196362.1.46228 WP_001196362.1.46276 WP_001196362.1.46330 WP_001196362.1.46334 WP_001196362.1.46362 WP_001196362.1.46368 WP_001196362.1.46380 WP_001196362.1.46401 WP_001196362.1.46422 WP_001196362.1.46465 WP_001196362.1.46543 WP_001196362.1.4662 WP_001196362.1.46660 WP_001196362.1.46664 WP_001196362.1.46670 WP_001196362.1.46692 WP_001196362.1.46702 WP_001196362.1.46703 WP_001196362.1.46752 WP_001196362.1.46765 WP_001196362.1.46852 WP_001196362.1.46881 WP_001196362.1.46908 WP_001196362.1.46925 WP_001196362.1.46937 WP_001196362.1.4696 WP_001196362.1.46983 WP_001196362.1.46995 WP_001196362.1.47051 WP_001196362.1.47128 WP_001196362.1.47153 WP_001196362.1.47159 WP_001196362.1.47163 WP_001196362.1.47187 WP_001196362.1.47211 WP_001196362.1.47216 WP_001196362.1.47258 WP_001196362.1.47269 WP_001196362.1.47279 WP_001196362.1.4728 WP_001196362.1.47290 WP_001196362.1.47294 WP_001196362.1.47306 WP_001196362.1.47328 WP_001196362.1.47381 WP_001196362.1.47399 WP_001196362.1.47406 WP_001196362.1.47426 WP_001196362.1.47432 WP_001196362.1.47439 WP_001196362.1.47560 WP_001196362.1.47618 WP_001196362.1.4767 WP_001196362.1.477 WP_001196362.1.47733 WP_001196362.1.47763 WP_001196362.1.47782 WP_001196362.1.47836 WP_001196362.1.47859 WP_001196362.1.47872 WP_001196362.1.47873 WP_001196362.1.47904 WP_001196362.1.47996 WP_001196362.1.48011 WP_001196362.1.48030 WP_001196362.1.48047 WP_001196362.1.4805 WP_001196362.1.48149 WP_001196362.1.4815 WP_001196362.1.48154 WP_001196362.1.48169 WP_001196362.1.48186 WP_001196362.1.48227 WP_001196362.1.48236 WP_001196362.1.48250 WP_001196362.1.48284 WP_001196362.1.48293 WP_001196362.1.48307 WP_001196362.1.48322 WP_001196362.1.48391 WP_001196362.1.48394 WP_001196362.1.48463 WP_001196362.1.48563 WP_001196362.1.48577 WP_001196362.1.48593 WP_001196362.1.48634 WP_001196362.1.48656 WP_001196362.1.4868 WP_001196362.1.48705 WP_001196362.1.48711 WP_001196362.1.48805 WP_001196362.1.48823 WP_001196362.1.48833 WP_001196362.1.48835 WP_001196362.1.4886 WP_001196362.1.48936 WP_001196362.1.48941 WP_001196362.1.48945 WP_001196362.1.48951 WP_001196362.1.48968 WP_001196362.1.48982 WP_001196362.1.48993 WP_001196362.1.4901 WP_001196362.1.4905 WP_001196362.1.49129 WP_001196362.1.49159 WP_001196362.1.4916 WP_001196362.1.49161 WP_001196362.1.4917 WP_001196362.1.4918 WP_001196362.1.49207 WP_001196362.1.49248 WP_001196362.1.49327 WP_001196362.1.49398 WP_001196362.1.4950 WP_001196362.1.4962 WP_001196362.1.49653 WP_001196362.1.49669 WP_001196362.1.49730 WP_001196362.1.49742 WP_001196362.1.4980 WP_001196362.1.49800 WP_001196362.1.49860 WP_001196362.1.49871 WP_001196362.1.4989 WP_001196362.1.49894 WP_001196362.1.49907 WP_001196362.1.49934 WP_001196362.1.4994 WP_001196362.1.49970 WP_001196362.1.49982 WP_001196362.1.50013 WP_001196362.1.50038 WP_001196362.1.50039 WP_001196362.1.50061 WP_001196362.1.50076 WP_001196362.1.5013 WP_001196362.1.50138 WP_001196362.1.50217 WP_001196362.1.50219 WP_001196362.1.50261 WP_001196362.1.50313 WP_001196362.1.50314 WP_001196362.1.50356 WP_001196362.1.50425 WP_001196362.1.50430 WP_001196362.1.50536 WP_001196362.1.50555 WP_001196362.1.50578 WP_001196362.1.50595 WP_001196362.1.50660 WP_001196362.1.50768 WP_001196362.1.50799 WP_001196362.1.50820 WP_001196362.1.50884 WP_001196362.1.50896 WP_001196362.1.50937 WP_001196362.1.50962 WP_001196362.1.5109 WP_001196362.1.5110 WP_001196362.1.5111 WP_001196362.1.51152 WP_001196362.1.51236 WP_001196362.1.51245 WP_001196362.1.51250 WP_001196362.1.51295 WP_001196362.1.51306 WP_001196362.1.51310 WP_001196362.1.51346 WP_001196362.1.51376 WP_001196362.1.51403 WP_001196362.1.51454 WP_001196362.1.51456 WP_001196362.1.515 WP_001196362.1.51527 WP_001196362.1.5155 WP_001196362.1.51559 WP_001196362.1.51575 WP_001196362.1.51590 WP_001196362.1.51665 WP_001196362.1.51716 WP_001196362.1.51748 WP_001196362.1.51797 WP_001196362.1.51836 WP_001196362.1.51842 WP_001196362.1.51844 WP_001196362.1.51871 WP_001196362.1.51883 WP_001196362.1.51924 WP_001196362.1.51936 WP_001196362.1.51952 WP_001196362.1.51971 WP_001196362.1.51995 WP_001196362.1.52078 WP_001196362.1.521 WP_001196362.1.5213 WP_001196362.1.52151 WP_001196362.1.52182 WP_001196362.1.52185 WP_001196362.1.52193 WP_001196362.1.52251 WP_001196362.1.52296 WP_001196362.1.523 WP_001196362.1.52322 WP_001196362.1.52327 WP_001196362.1.52331 WP_001196362.1.52340 WP_001196362.1.52440 WP_001196362.1.52442 WP_001196362.1.52463 WP_001196362.1.52518 WP_001196362.1.52548 WP_001196362.1.52595 WP_001196362.1.52623 WP_001196362.1.52624 WP_001196362.1.52645 WP_001196362.1.52687 WP_001196362.1.52699 WP_001196362.1.52715 WP_001196362.1.52722 WP_001196362.1.52848 WP_001196362.1.52877 WP_001196362.1.52878 WP_001196362.1.52941 WP_001196362.1.52947 WP_001196362.1.52984 WP_001196362.1.53002 WP_001196362.1.53071 WP_001196362.1.53140 WP_001196362.1.53153 WP_001196362.1.53178 WP_001196362.1.53209 WP_001196362.1.53260 WP_001196362.1.53317 WP_001196362.1.53319 WP_001196362.1.53387 WP_001196362.1.53394 WP_001196362.1.53403 WP_001196362.1.53432 WP_001196362.1.53462 WP_001196362.1.53521 WP_001196362.1.53577 WP_001196362.1.53641 WP_001196362.1.53648 WP_001196362.1.53671 WP_001196362.1.53766 WP_001196362.1.53827 WP_001196362.1.53835 WP_001196362.1.53889 WP_001196362.1.53915 WP_001196362.1.53934 WP_001196362.1.53969 WP_001196362.1.53999 WP_001196362.1.5401 WP_001196362.1.54022 WP_001196362.1.54109 WP_001196362.1.54147 WP_001196362.1.54229 WP_001196362.1.54253 WP_001196362.1.54297 WP_001196362.1.54395 WP_001196362.1.544 WP_001196362.1.54413 WP_001196362.1.54503 WP_001196362.1.54510 WP_001196362.1.54551 WP_001196362.1.54637 WP_001196362.1.54675 WP_001196362.1.5469 WP_001196362.1.54745 WP_001196362.1.54753 WP_001196362.1.54878 WP_001196362.1.54955 WP_001196362.1.55014 WP_001196362.1.5519 WP_001196362.1.55214 WP_001196362.1.55274 WP_001196362.1.55309 WP_001196362.1.55367 WP_001196362.1.55369 WP_001196362.1.55403 WP_001196362.1.55405 WP_001196362.1.55421 WP_001196362.1.55508 WP_001196362.1.5554 WP_001196362.1.55544 WP_001196362.1.55558 WP_001196362.1.5556 WP_001196362.1.55583 WP_001196362.1.5559 WP_001196362.1.55628 WP_001196362.1.55637 WP_001196362.1.55653 WP_001196362.1.557 WP_001196362.1.55728 WP_001196362.1.55786 WP_001196362.1.5580 WP_001196362.1.55818 WP_001196362.1.55831 WP_001196362.1.55835 WP_001196362.1.55867 WP_001196362.1.55886 WP_001196362.1.5589 WP_001196362.1.55904 WP_001196362.1.55916 WP_001196362.1.55933 WP_001196362.1.55953 WP_001196362.1.56000 WP_001196362.1.56025 WP_001196362.1.56048 WP_001196362.1.56078 WP_001196362.1.56098 WP_001196362.1.56225 WP_001196362.1.5623 WP_001196362.1.56239 WP_001196362.1.56281 WP_001196362.1.56332 WP_001196362.1.56333 WP_001196362.1.5635 WP_001196362.1.56400 WP_001196362.1.5644 WP_001196362.1.56558 WP_001196362.1.5658 WP_001196362.1.56598 WP_001196362.1.566 WP_001196362.1.56628 WP_001196362.1.56641 WP_001196362.1.56658 WP_001196362.1.5666 WP_001196362.1.5677 WP_001196362.1.56778 WP_001196362.1.56794 WP_001196362.1.56815 WP_001196362.1.56856 WP_001196362.1.5686 WP_001196362.1.56865 WP_001196362.1.56878 WP_001196362.1.569 WP_001196362.1.56986 WP_001196362.1.57047 WP_001196362.1.57073 WP_001196362.1.57075 WP_001196362.1.57097 WP_001196362.1.57109 WP_001196362.1.57170 WP_001196362.1.5718 WP_001196362.1.57190 WP_001196362.1.57214 WP_001196362.1.57265 WP_001196362.1.57309 WP_001196362.1.57445 WP_001196362.1.57481 WP_001196362.1.57594 WP_001196362.1.57650 WP_001196362.1.57665 WP_001196362.1.57682 WP_001196362.1.57692 WP_001196362.1.57730 WP_001196362.1.57734 WP_001196362.1.57754 WP_001196362.1.57808 WP_001196362.1.57819 WP_001196362.1.57837 WP_001196362.1.57840 WP_001196362.1.57861 WP_001196362.1.57878 WP_001196362.1.5791 WP_001196362.1.57952 WP_001196362.1.57974 WP_001196362.1.58016 WP_001196362.1.58049 WP_001196362.1.58074 WP_001196362.1.58116 WP_001196362.1.58127 WP_001196362.1.58148 WP_001196362.1.58158 WP_001196362.1.5816 WP_001196362.1.58277 WP_001196362.1.58317 WP_001196362.1.58352 WP_001196362.1.58364 WP_001196362.1.58395 WP_001196362.1.58430 WP_001196362.1.58435 WP_001196362.1.58512 WP_001196362.1.58530 WP_001196362.1.5857 WP_001196362.1.58571 WP_001196362.1.58592 WP_001196362.1.58598 WP_001196362.1.58704 WP_001196362.1.58735 WP_001196362.1.58760 WP_001196362.1.58763 WP_001196362.1.58772 WP_001196362.1.5880 WP_001196362.1.58833 WP_001196362.1.58934 WP_001196362.1.58981 WP_001196362.1.59011 WP_001196362.1.59014 WP_001196362.1.59039 WP_001196362.1.59077 WP_001196362.1.59098 WP_001196362.1.59124 WP_001196362.1.59146 WP_001196362.1.5920 WP_001196362.1.59311 WP_001196362.1.59398 WP_001196362.1.5940 WP_001196362.1.59404 WP_001196362.1.59462 WP_001196362.1.59464 WP_001196362.1.59498 WP_001196362.1.59540 WP_001196362.1.59546 WP_001196362.1.59598 WP_001196362.1.59668 WP_001196362.1.59669 WP_001196362.1.59671 WP_001196362.1.5972 WP_001196362.1.59787 WP_001196362.1.5982 WP_001196362.1.59822 WP_001196362.1.59874 WP_001196362.1.59907 WP_001196362.1.59915 WP_001196362.1.60006 WP_001196362.1.6006 WP_001196362.1.6011 WP_001196362.1.60123 WP_001196362.1.60147 WP_001196362.1.60149 WP_001196362.1.60157 WP_001196362.1.6017 WP_001196362.1.60227 WP_001196362.1.60302 WP_001196362.1.60345 WP_001196362.1.60353 WP_001196362.1.60360 WP_001196362.1.60434 WP_001196362.1.60492 WP_001196362.1.60547 WP_001196362.1.60585 WP_001196362.1.60595 WP_001196362.1.60636 WP_001196362.1.60641 WP_001196362.1.60734 WP_001196362.1.60750 WP_001196362.1.60751 WP_001196362.1.60758 WP_001196362.1.60759 WP_001196362.1.60765 WP_001196362.1.60778 WP_001196362.1.60813 WP_001196362.1.60820 WP_001196362.1.60845 WP_001196362.1.6085 WP_001196362.1.60869 WP_001196362.1.60888 WP_001196362.1.60912 WP_001196362.1.60923 WP_001196362.1.60948 WP_001196362.1.60965 WP_001196362.1.60991 WP_001196362.1.61013 WP_001196362.1.61023 WP_001196362.1.61026 WP_001196362.1.61029 WP_001196362.1.61031 WP_001196362.1.61082 WP_001196362.1.61115 WP_001196362.1.61139 WP_001196362.1.61189 WP_001196362.1.6119 WP_001196362.1.6123 WP_001196362.1.61263 WP_001196362.1.61271 WP_001196362.1.61286 WP_001196362.1.61289 WP_001196362.1.61313 WP_001196362.1.61316 WP_001196362.1.6136 WP_001196362.1.61375 WP_001196362.1.61430 WP_001196362.1.61439 WP_001196362.1.61440 WP_001196362.1.61555 WP_001196362.1.61585 WP_001196362.1.61597 WP_001196362.1.61615 WP_001196362.1.61639 WP_001196362.1.6166 WP_001196362.1.61705 WP_001196362.1.61749 WP_001196362.1.61800 WP_001196362.1.61802 WP_001196362.1.61838 WP_001196362.1.61903 WP_001196362.1.61936 WP_001196362.1.61978 WP_001196362.1.62002 WP_001196362.1.6201 WP_001196362.1.62028 WP_001196362.1.62069 WP_001196362.1.62071 WP_001196362.1.62096 WP_001196362.1.62247 WP_001196362.1.62254 WP_001196362.1.62346 WP_001196362.1.62352 WP_001196362.1.62382 WP_001196362.1.62398 WP_001196362.1.62429 WP_001196362.1.62453 WP_001196362.1.62474 WP_001196362.1.62496 WP_001196362.1.6250 WP_001196362.1.62553 WP_001196362.1.62602 WP_001196362.1.62653 WP_001196362.1.62671 WP_001196362.1.62674 WP_001196362.1.6268 WP_001196362.1.62684 WP_001196362.1.62723 WP_001196362.1.62764 WP_001196362.1.62771 WP_001196362.1.62822 WP_001196362.1.62824 WP_001196362.1.62831 WP_001196362.1.62863 WP_001196362.1.62880 WP_001196362.1.62970 WP_001196362.1.63003 WP_001196362.1.63027 WP_001196362.1.63052 WP_001196362.1.63070 WP_001196362.1.63083 WP_001196362.1.63139 WP_001196362.1.63140 WP_001196362.1.63220 WP_001196362.1.63266 WP_001196362.1.63289 WP_001196362.1.63304 WP_001196362.1.63313 WP_001196362.1.63333 WP_001196362.1.63341 WP_001196362.1.63441 WP_001196362.1.63469 WP_001196362.1.63471 WP_001196362.1.63589 WP_001196362.1.63673 WP_001196362.1.63678 WP_001196362.1.63726 WP_001196362.1.63751 WP_001196362.1.63759 WP_001196362.1.63774 WP_001196362.1.63828 WP_001196362.1.6388 WP_001196362.1.63907 WP_001196362.1.6403 WP_001196362.1.6408 WP_001196362.1.64192 WP_001196362.1.64250 WP_001196362.1.64367 WP_001196362.1.6438 WP_001196362.1.64456 WP_001196362.1.64457 WP_001196362.1.64525 WP_001196362.1.64565 WP_001196362.1.64583 WP_001196362.1.6459 WP_001196362.1.6462 WP_001196362.1.64677 WP_001196362.1.64686 WP_001196362.1.64720 WP_001196362.1.64765 WP_001196362.1.6479 WP_001196362.1.64858 WP_001196362.1.64879 WP_001196362.1.6488 WP_001196362.1.64893 WP_001196362.1.64897 WP_001196362.1.64928 WP_001196362.1.64935 WP_001196362.1.64961 WP_001196362.1.65044 WP_001196362.1.65132 WP_001196362.1.65158 WP_001196362.1.65180 WP_001196362.1.65193 WP_001196362.1.65217 WP_001196362.1.65243 WP_001196362.1.65317 WP_001196362.1.65367 WP_001196362.1.65419 WP_001196362.1.65423 WP_001196362.1.65432 WP_001196362.1.65443 WP_001196362.1.65451 WP_001196362.1.6547 WP_001196362.1.65504 WP_001196362.1.6551 WP_001196362.1.65520 WP_001196362.1.65544 WP_001196362.1.65562 WP_001196362.1.65675 WP_001196362.1.65689 WP_001196362.1.65693 WP_001196362.1.65700 WP_001196362.1.65703 WP_001196362.1.65705 WP_001196362.1.65856 WP_001196362.1.65922 WP_001196362.1.65931 WP_001196362.1.66009 WP_001196362.1.66081 WP_001196362.1.661 WP_001196362.1.66120 WP_001196362.1.66133 WP_001196362.1.66175 WP_001196362.1.66262 WP_001196362.1.66302 WP_001196362.1.66433 WP_001196362.1.66505 WP_001196362.1.66519 WP_001196362.1.66542 WP_001196362.1.66564 WP_001196362.1.66588 WP_001196362.1.66601 WP_001196362.1.66606 WP_001196362.1.66664 WP_001196362.1.66677 WP_001196362.1.66711 WP_001196362.1.6674 WP_001196362.1.66786 WP_001196362.1.66818 WP_001196362.1.6684 WP_001196362.1.67112 WP_001196362.1.67135 WP_001196362.1.67191 WP_001196362.1.6722 WP_001196362.1.67266 WP_001196362.1.67329 WP_001196362.1.67333 WP_001196362.1.67379 WP_001196362.1.6740 WP_001196362.1.67414 WP_001196362.1.67463 WP_001196362.1.67480 WP_001196362.1.67505 WP_001196362.1.67507 WP_001196362.1.67520 WP_001196362.1.67521 WP_001196362.1.67554 WP_001196362.1.67572 WP_001196362.1.67632 WP_001196362.1.67651 WP_001196362.1.67652 WP_001196362.1.67713 WP_001196362.1.67722 WP_001196362.1.67754 WP_001196362.1.67815 WP_001196362.1.6786 WP_001196362.1.67865 WP_001196362.1.67925 WP_001196362.1.67986 WP_001196362.1.68033 WP_001196362.1.68054 WP_001196362.1.68066 WP_001196362.1.6811 WP_001196362.1.68111 WP_001196362.1.68160 WP_001196362.1.68161 WP_001196362.1.68199 WP_001196362.1.68261 WP_001196362.1.68295 WP_001196362.1.6830 WP_001196362.1.68307 WP_001196362.1.6834 WP_001196362.1.68343 WP_001196362.1.68351 WP_001196362.1.68367 WP_001196362.1.6839 WP_001196362.1.68397 WP_001196362.1.68404 WP_001196362.1.68425 WP_001196362.1.68483 WP_001196362.1.68489 WP_001196362.1.68522 WP_001196362.1.68565 WP_001196362.1.68650 WP_001196362.1.68699 WP_001196362.1.68703 WP_001196362.1.68728 WP_001196362.1.68737 WP_001196362.1.68775 WP_001196362.1.68813 WP_001196362.1.68831 WP_001196362.1.68854 WP_001196362.1.68875 WP_001196362.1.68943 WP_001196362.1.68944 WP_001196362.1.69045 WP_001196362.1.69087 WP_001196362.1.69089 WP_001196362.1.6917 WP_001196362.1.69191 WP_001196362.1.69219 WP_001196362.1.69222 WP_001196362.1.69237 WP_001196362.1.69366 WP_001196362.1.69395 WP_001196362.1.69415 WP_001196362.1.69476 WP_001196362.1.69480 WP_001196362.1.695 WP_001196362.1.69552 WP_001196362.1.69563 WP_001196362.1.69622 WP_001196362.1.69679 WP_001196362.1.69877 WP_001196362.1.69878 WP_001196362.1.69921 WP_001196362.1.69987 WP_001196362.1.70024 WP_001196362.1.70048 WP_001196362.1.70105 WP_001196362.1.7012 WP_001196362.1.70133 WP_001196362.1.7024 WP_001196362.1.70253 WP_001196362.1.70273 WP_001196362.1.7034 WP_001196362.1.70344 WP_001196362.1.70349 WP_001196362.1.7043 WP_001196362.1.70451 WP_001196362.1.70459 WP_001196362.1.70462 WP_001196362.1.7053 WP_001196362.1.70546 WP_001196362.1.7061 WP_001196362.1.70635 WP_001196362.1.70641 WP_001196362.1.7067 WP_001196362.1.7073 WP_001196362.1.70818 WP_001196362.1.70823 WP_001196362.1.70855 WP_001196362.1.70924 WP_001196362.1.70930 WP_001196362.1.70943 WP_001196362.1.71043 WP_001196362.1.71058 WP_001196362.1.71059 WP_001196362.1.71073 WP_001196362.1.7109 WP_001196362.1.71130 WP_001196362.1.71196 WP_001196362.1.7120 WP_001196362.1.7125 WP_001196362.1.71257 WP_001196362.1.71295 WP_001196362.1.71298 WP_001196362.1.71325 WP_001196362.1.71345 WP_001196362.1.71359 WP_001196362.1.71463 WP_001196362.1.7150 WP_001196362.1.71519 WP_001196362.1.71529 WP_001196362.1.71543 WP_001196362.1.71596 WP_001196362.1.71602 WP_001196362.1.7161 WP_001196362.1.71662 WP_001196362.1.71676 WP_001196362.1.71735 WP_001196362.1.7179 WP_001196362.1.71861 WP_001196362.1.71925 WP_001196362.1.71989 WP_001196362.1.72026 WP_001196362.1.72031 WP_001196362.1.72067 WP_001196362.1.72169 WP_001196362.1.72205 WP_001196362.1.72271 WP_001196362.1.72330 WP_001196362.1.72347 WP_001196362.1.7236 WP_001196362.1.72366 WP_001196362.1.72424 WP_001196362.1.72547 WP_001196362.1.72654 WP_001196362.1.72787 WP_001196362.1.72832 WP_001196362.1.72834 WP_001196362.1.72835 WP_001196362.1.72903 WP_001196362.1.72904 WP_001196362.1.72935 WP_001196362.1.72945 WP_001196362.1.73017 WP_001196362.1.73019 WP_001196362.1.73022 WP_001196362.1.73037 WP_001196362.1.73122 WP_001196362.1.73132 WP_001196362.1.73246 WP_001196362.1.73265 WP_001196362.1.73286 WP_001196362.1.73386 WP_001196362.1.73456 WP_001196362.1.73501 WP_001196362.1.73571 WP_001196362.1.73591 WP_001196362.1.736 WP_001196362.1.73639 WP_001196362.1.73685 WP_001196362.1.73735 WP_001196362.1.73759 WP_001196362.1.73786 WP_001196362.1.7380 WP_001196362.1.73834 WP_001196362.1.73858 WP_001196362.1.73910 WP_001196362.1.73920 WP_001196362.1.73961 WP_001196362.1.73969 WP_001196362.1.73976 WP_001196362.1.73983 WP_001196362.1.74006 WP_001196362.1.74010 WP_001196362.1.74027 WP_001196362.1.74081 WP_001196362.1.74157 WP_001196362.1.74161 WP_001196362.1.74173 WP_001196362.1.74183 WP_001196362.1.74216 WP_001196362.1.74234 WP_001196362.1.74237 WP_001196362.1.7427 WP_001196362.1.7434 WP_001196362.1.74353 WP_001196362.1.74356 WP_001196362.1.74380 WP_001196362.1.74429 WP_001196362.1.74457 WP_001196362.1.7457 WP_001196362.1.74587 WP_001196362.1.74610 WP_001196362.1.74638 WP_001196362.1.74696 WP_001196362.1.74704 WP_001196362.1.74731 WP_001196362.1.74747 WP_001196362.1.74802 WP_001196362.1.74866 WP_001196362.1.74890 WP_001196362.1.74911 WP_001196362.1.74922 WP_001196362.1.74961 WP_001196362.1.74994 WP_001196362.1.74999 WP_001196362.1.75038 WP_001196362.1.75044 WP_001196362.1.75052 WP_001196362.1.75186 WP_001196362.1.75252 WP_001196362.1.75253 WP_001196362.1.75294 WP_001196362.1.75298 WP_001196362.1.75320 WP_001196362.1.75327 WP_001196362.1.75349 WP_001196362.1.75365 WP_001196362.1.75399 WP_001196362.1.7542 WP_001196362.1.75438 WP_001196362.1.75440 WP_001196362.1.75527 WP_001196362.1.75551 WP_001196362.1.7561 WP_001196362.1.75649 WP_001196362.1.75652 WP_001196362.1.75685 WP_001196362.1.75769 WP_001196362.1.75775 WP_001196362.1.758 WP_001196362.1.75830 WP_001196362.1.75881 WP_001196362.1.75885 WP_001196362.1.75929 WP_001196362.1.75952 WP_001196362.1.7596 WP_001196362.1.75969 WP_001196362.1.76010 WP_001196362.1.76015 WP_001196362.1.76095 WP_001196362.1.76143 WP_001196362.1.76230 WP_001196362.1.76234 WP_001196362.1.7624 WP_001196362.1.7625 WP_001196362.1.76258 WP_001196362.1.76261 WP_001196362.1.76332 WP_001196362.1.76337 WP_001196362.1.76351 WP_001196362.1.76419 WP_001196362.1.76420 WP_001196362.1.76421 WP_001196362.1.76606 WP_001196362.1.76624 WP_001196362.1.76648 WP_001196362.1.76686 WP_001196362.1.76690 WP_001196362.1.76693 WP_001196362.1.7675 WP_001196362.1.76790 WP_001196362.1.76792 WP_001196362.1.768 WP_001196362.1.76816 WP_001196362.1.76839 WP_001196362.1.76845 WP_001196362.1.76897 WP_001196362.1.76921 WP_001196362.1.76944 WP_001196362.1.76952 WP_001196362.1.76998 WP_001196362.1.77031 WP_001196362.1.77041 WP_001196362.1.77050 WP_001196362.1.77060 WP_001196362.1.77062 WP_001196362.1.77112 WP_001196362.1.77145 WP_001196362.1.77305 WP_001196362.1.7746 WP_001196362.1.77489 WP_001196362.1.77497 WP_001196362.1.77520 WP_001196362.1.77527 WP_001196362.1.77533 WP_001196362.1.77536 WP_001196362.1.77572 WP_001196362.1.77603 WP_001196362.1.77606 WP_001196362.1.77738 WP_001196362.1.7774 WP_001196362.1.77743 WP_001196362.1.77818 WP_001196362.1.77822 WP_001196362.1.77858 WP_001196362.1.7787 WP_001196362.1.77957 WP_001196362.1.78054 WP_001196362.1.78091 WP_001196362.1.78173 WP_001196362.1.78189 WP_001196362.1.78207 WP_001196362.1.78252 WP_001196362.1.78254 WP_001196362.1.78257 WP_001196362.1.7827 WP_001196362.1.78311 WP_001196362.1.78332 WP_001196362.1.78365 WP_001196362.1.78404 WP_001196362.1.7850 WP_001196362.1.78558 WP_001196362.1.7857 WP_001196362.1.78604 WP_001196362.1.78653 WP_001196362.1.78667 WP_001196362.1.78728 WP_001196362.1.78803 WP_001196362.1.78819 WP_001196362.1.78841 WP_001196362.1.78897 WP_001196362.1.78983 WP_001196362.1.7900 WP_001196362.1.79006 WP_001196362.1.79038 WP_001196362.1.79051 WP_001196362.1.79085 WP_001196362.1.79131 WP_001196362.1.79170 WP_001196362.1.79197 WP_001196362.1.79208 WP_001196362.1.79223 WP_001196362.1.7931 WP_001196362.1.79310 WP_001196362.1.79314 WP_001196362.1.79322 WP_001196362.1.79332 WP_001196362.1.79367 WP_001196362.1.79374 WP_001196362.1.79436 WP_001196362.1.79461 WP_001196362.1.79476 WP_001196362.1.79487 WP_001196362.1.79539 WP_001196362.1.79556 WP_001196362.1.79626 WP_001196362.1.79662 WP_001196362.1.79672 WP_001196362.1.79706 WP_001196362.1.79822 WP_001196362.1.79831 WP_001196362.1.79834 WP_001196362.1.79837 WP_001196362.1.7989 WP_001196362.1.79896 WP_001196362.1.79911 WP_001196362.1.7992 WP_001196362.1.79941 WP_001196362.1.79961 WP_001196362.1.79971 WP_001196362.1.79991 WP_001196362.1.80000 WP_001196362.1.80032 WP_001196362.1.80042 WP_001196362.1.80079 WP_001196362.1.80109 WP_001196362.1.80127 WP_001196362.1.80203 WP_001196362.1.80287 WP_001196362.1.80290 WP_001196362.1.8031 WP_001196362.1.8035 WP_001196362.1.80358 WP_001196362.1.80378 WP_001196362.1.8043 WP_001196362.1.80472 WP_001196362.1.80530 WP_001196362.1.8065 WP_001196362.1.80687 WP_001196362.1.80717 WP_001196362.1.80761 WP_001196362.1.80763 WP_001196362.1.80781 WP_001196362.1.80786 WP_001196362.1.80833 WP_001196362.1.8084 WP_001196362.1.80872 WP_001196362.1.80962 WP_001196362.1.81085 WP_001196362.1.81114 WP_001196362.1.81157 WP_001196362.1.81171 WP_001196362.1.81234 WP_001196362.1.8125 WP_001196362.1.81252 WP_001196362.1.8135 WP_001196362.1.81385 WP_001196362.1.81389 WP_001196362.1.8142 WP_001196362.1.8144 WP_001196362.1.81464 WP_001196362.1.81467 WP_001196362.1.81599 WP_001196362.1.81610 WP_001196362.1.81740 WP_001196362.1.81800 WP_001196362.1.81810 WP_001196362.1.81812 WP_001196362.1.81831 WP_001196362.1.81861 WP_001196362.1.81870 WP_001196362.1.81897 WP_001196362.1.81903 WP_001196362.1.81905 WP_001196362.1.81906 WP_001196362.1.81919 WP_001196362.1.81944 WP_001196362.1.81955 WP_001196362.1.81999 WP_001196362.1.82009 WP_001196362.1.82053 WP_001196362.1.8212 WP_001196362.1.82121 WP_001196362.1.82219 WP_001196362.1.82247 WP_001196362.1.82259 WP_001196362.1.82340 WP_001196362.1.82354 WP_001196362.1.82358 WP_001196362.1.82368 WP_001196362.1.82447 WP_001196362.1.8246 WP_001196362.1.82467 WP_001196362.1.82548 WP_001196362.1.82612 WP_001196362.1.8265 WP_001196362.1.82709 WP_001196362.1.82724 WP_001196362.1.82796 WP_001196362.1.8280 WP_001196362.1.82802 WP_001196362.1.82829 WP_001196362.1.82862 WP_001196362.1.8289 WP_001196362.1.82976 WP_001196362.1.82980 WP_001196362.1.83152 WP_001196362.1.83153 WP_001196362.1.83185 WP_001196362.1.83193 WP_001196362.1.83234 WP_001196362.1.83316 WP_001196362.1.83352 WP_001196362.1.83372 WP_001196362.1.83418 WP_001196362.1.83476 WP_001196362.1.83484 WP_001196362.1.83517 WP_001196362.1.83593 WP_001196362.1.83646 WP_001196362.1.83653 WP_001196362.1.83676 WP_001196362.1.83720 WP_001196362.1.83763 WP_001196362.1.83769 WP_001196362.1.83775 WP_001196362.1.83804 WP_001196362.1.83825 WP_001196362.1.8383 WP_001196362.1.83864 WP_001196362.1.83865 WP_001196362.1.83881 WP_001196362.1.83912 WP_001196362.1.83919 WP_001196362.1.83928 WP_001196362.1.83955 WP_001196362.1.83984 WP_001196362.1.84049 WP_001196362.1.84064 WP_001196362.1.84144 WP_001196362.1.84163 WP_001196362.1.84293 WP_001196362.1.84342 WP_001196362.1.84442 WP_001196362.1.84445 WP_001196362.1.84451 WP_001196362.1.84509 WP_001196362.1.84563 WP_001196362.1.84578 WP_001196362.1.84625 WP_001196362.1.84638 WP_001196362.1.8468 WP_001196362.1.84682 WP_001196362.1.8475 WP_001196362.1.84752 WP_001196362.1.84757 WP_001196362.1.84761 WP_001196362.1.84815 WP_001196362.1.84889 WP_001196362.1.84903 WP_001196362.1.84907 WP_001196362.1.84922 WP_001196362.1.8493 WP_001196362.1.85022 WP_001196362.1.85047 WP_001196362.1.85056 WP_001196362.1.85081 WP_001196362.1.85099 WP_001196362.1.85135 WP_001196362.1.85144 WP_001196362.1.85151 WP_001196362.1.85226 WP_001196362.1.85235 WP_001196362.1.85238 WP_001196362.1.85351 WP_001196362.1.85383 WP_001196362.1.85395 WP_001196362.1.85404 WP_001196362.1.85445 WP_001196362.1.85462 WP_001196362.1.85471 WP_001196362.1.85474 WP_001196362.1.85492 WP_001196362.1.85506 WP_001196362.1.85515 WP_001196362.1.85519 WP_001196362.1.85547 WP_001196362.1.85586 WP_001196362.1.85649 WP_001196362.1.85758 WP_001196362.1.85795 WP_001196362.1.85796 WP_001196362.1.85816 WP_001196362.1.85834 WP_001196362.1.85927 WP_001196362.1.85950 WP_001196362.1.85993 WP_001196362.1.86018 WP_001196362.1.86072 WP_001196362.1.86123 WP_001196362.1.86144 WP_001196362.1.86154 WP_001196362.1.86158 WP_001196362.1.86188 WP_001196362.1.86207 WP_001196362.1.8627 WP_001196362.1.86270 WP_001196362.1.86304 WP_001196362.1.86344 WP_001196362.1.86367 WP_001196362.1.86378 WP_001196362.1.8643 WP_001196362.1.86439 WP_001196362.1.86482 WP_001196362.1.86523 WP_001196362.1.86542 WP_001196362.1.86628 WP_001196362.1.86706 WP_001196362.1.86792 WP_001196362.1.8681 WP_001196362.1.86838 WP_001196362.1.86911 WP_001196362.1.86940 WP_001196362.1.86961 WP_001196362.1.86977 WP_001196362.1.87021 WP_001196362.1.87042 WP_001196362.1.87057 WP_001196362.1.87072 WP_001196362.1.87090 WP_001196362.1.87119 WP_001196362.1.87122 WP_001196362.1.87141 WP_001196362.1.87175 WP_001196362.1.87194 WP_001196362.1.8720 WP_001196362.1.87260 WP_001196362.1.87261 WP_001196362.1.87285 WP_001196362.1.87290 WP_001196362.1.8731 WP_001196362.1.87396 WP_001196362.1.87457 WP_001196362.1.87461 WP_001196362.1.87466 WP_001196362.1.875 WP_001196362.1.87508 WP_001196362.1.87515 WP_001196362.1.8753 WP_001196362.1.87543 WP_001196362.1.87710 WP_001196362.1.87718 WP_001196362.1.87748 WP_001196362.1.87764 WP_001196362.1.8779 WP_001196362.1.87808 WP_001196362.1.87828 WP_001196362.1.87879 WP_001196362.1.87912 WP_001196362.1.87963 WP_001196362.1.87972 WP_001196362.1.87995 WP_001196362.1.88013 WP_001196362.1.88032 WP_001196362.1.88061 WP_001196362.1.88114 WP_001196362.1.88150 WP_001196362.1.88270 WP_001196362.1.88317 WP_001196362.1.88319 WP_001196362.1.88351 WP_001196362.1.88367 WP_001196362.1.88371 WP_001196362.1.88380 WP_001196362.1.88480 WP_001196362.1.88498 WP_001196362.1.88518 WP_001196362.1.88558 WP_001196362.1.8857 WP_001196362.1.88580 WP_001196362.1.88599 WP_001196362.1.88623 WP_001196362.1.88636 WP_001196362.1.88642 WP_001196362.1.88671 WP_001196362.1.88694 WP_001196362.1.8872 WP_001196362.1.88739 WP_001196362.1.88856 WP_001196362.1.88859 WP_001196362.1.8888 WP_001196362.1.88934 WP_001196362.1.8900 WP_001196362.1.89086 WP_001196362.1.8913 WP_001196362.1.89133 WP_001196362.1.89181 WP_001196362.1.89194 WP_001196362.1.89195 WP_001196362.1.89204 WP_001196362.1.8924 WP_001196362.1.89258 WP_001196362.1.89284 WP_001196362.1.89516 WP_001196362.1.89537 WP_001196362.1.89544 WP_001196362.1.89545 WP_001196362.1.89559 WP_001196362.1.89655 WP_001196362.1.89672 WP_001196362.1.89678 WP_001196362.1.89726 WP_001196362.1.89730 WP_001196362.1.89754 WP_001196362.1.89883 WP_001196362.1.89935 WP_001196362.1.89960 WP_001196362.1.90005 WP_001196362.1.90018 WP_001196362.1.90038 WP_001196362.1.90046 WP_001196362.1.90055 WP_001196362.1.90091 WP_001196362.1.90131 WP_001196362.1.90148 WP_001196362.1.90161 WP_001196362.1.90180 WP_001196362.1.90215 WP_001196362.1.90243 WP_001196362.1.90253 WP_001196362.1.90276 WP_001196362.1.9030 WP_001196362.1.90331 WP_001196362.1.90367 WP_001196362.1.90473 WP_001196362.1.90544 WP_001196362.1.90554 WP_001196362.1.90604 WP_001196362.1.90647 WP_001196362.1.90660 WP_001196362.1.90683 WP_001196362.1.90726 WP_001196362.1.90728 WP_001196362.1.90738 WP_001196362.1.90745 WP_001196362.1.90801 WP_001196362.1.90804 WP_001196362.1.90861 WP_001196362.1.90896 WP_001196362.1.90903 WP_001196362.1.9100 WP_001196362.1.91011 WP_001196362.1.91054 WP_001196362.1.91126 WP_001196362.1.9114 WP_001196362.1.91158 WP_001196362.1.91177 WP_001196362.1.912 WP_001196362.1.91233 WP_001196362.1.91246 WP_001196362.1.91258 WP_001196362.1.91279 WP_001196362.1.91300 WP_001196362.1.91332 WP_001196362.1.91346 WP_001196362.1.91357 WP_001196362.1.91364 WP_001196362.1.91382 WP_001196362.1.9140 WP_001196362.1.91420 WP_001196362.1.91427 WP_001196362.1.91500 WP_001196362.1.91559 WP_001196362.1.91573 WP_001196362.1.91581 WP_001196362.1.91587 WP_001196362.1.91639 WP_001196362.1.91749 WP_001196362.1.91771 WP_001196362.1.91791 WP_001196362.1.91800 WP_001196362.1.91816 WP_001196362.1.91829 WP_001196362.1.91895 WP_001196362.1.91928 WP_001196362.1.91950 WP_001196362.1.92 WP_001196362.1.92133 WP_001196362.1.92140 WP_001196362.1.92164 WP_001196362.1.92169 WP_001196362.1.92173 WP_001196362.1.92185 WP_001196362.1.92196 WP_001196362.1.92227 WP_001196362.1.9224 WP_001196362.1.92253 WP_001196362.1.9234 WP_001196362.1.9239 WP_001196362.1.92436 WP_001196362.1.92442 WP_001196362.1.92497 WP_001196362.1.92500 WP_001196362.1.92520 WP_001196362.1.92534 WP_001196362.1.92565 WP_001196362.1.92607 WP_001196362.1.92679 WP_001196362.1.92691 WP_001196362.1.92723 WP_001196362.1.92735 WP_001196362.1.92741 WP_001196362.1.92773 WP_001196362.1.92789 WP_001196362.1.92805 WP_001196362.1.92862 WP_001196362.1.92864 WP_001196362.1.9293 WP_001196362.1.92950 WP_001196362.1.93074 WP_001196362.1.93125 WP_001196362.1.93163 WP_001196362.1.93176 WP_001196362.1.93191 WP_001196362.1.93224 WP_001196362.1.93300 WP_001196362.1.93336 WP_001196362.1.93416 WP_001196362.1.93438 WP_001196362.1.93444 WP_001196362.1.93514 WP_001196362.1.9352 WP_001196362.1.9354 WP_001196362.1.9358 WP_001196362.1.93590 WP_001196362.1.93658 WP_001196362.1.93678 WP_001196362.1.93710 WP_001196362.1.93722 WP_001196362.1.93738 WP_001196362.1.93769 WP_001196362.1.93787 WP_001196362.1.9387 WP_001196362.1.93882 WP_001196362.1.93883 WP_001196362.1.93891 WP_001196362.1.93976 WP_001196362.1.9398 WP_001196362.1.93981 WP_001196362.1.94074 WP_001196362.1.94082 WP_001196362.1.94087 WP_001196362.1.94096 WP_001196362.1.94119 WP_001196362.1.94165 WP_001196362.1.94172 WP_001196362.1.94293 WP_001196362.1.94294 WP_001196362.1.94335 WP_001196362.1.94340 WP_001196362.1.9437 WP_001196362.1.94374 WP_001196362.1.94375 WP_001196362.1.94376 WP_001196362.1.94389 WP_001196362.1.94414 WP_001196362.1.94530 WP_001196362.1.94550 WP_001196362.1.94576 WP_001196362.1.9464 WP_001196362.1.94688 WP_001196362.1.94733 WP_001196362.1.94741 WP_001196362.1.94789 WP_001196362.1.94797 WP_001196362.1.94844 WP_001196362.1.94845 WP_001196362.1.9485 WP_001196362.1.94857 WP_001196362.1.94866 WP_001196362.1.9497 WP_001196362.1.94980 WP_001196362.1.94989 WP_001196362.1.94999 WP_001196362.1.95038 WP_001196362.1.95077 WP_001196362.1.9510 WP_001196362.1.95120 WP_001196362.1.95327 WP_001196362.1.95342 WP_001196362.1.95361 WP_001196362.1.95372 WP_001196362.1.9538 WP_001196362.1.95537 WP_001196362.1.95581 WP_001196362.1.95603 WP_001196362.1.95639 WP_001196362.1.95681 WP_001196362.1.95699 WP_001196362.1.95704 WP_001196362.1.95713 WP_001196362.1.95714 WP_001196362.1.95737 WP_001196362.1.95760 WP_001196362.1.95806 WP_001196362.1.95877 WP_001196362.1.95885 WP_001196362.1.95914 WP_001196362.1.95918 WP_001196362.1.95986 WP_001196362.1.95997 WP_001196362.1.96014 WP_001196362.1.96030 WP_001196362.1.96056 WP_001196362.1.96057 WP_001196362.1.96067 WP_001196362.1.96075 WP_001196362.1.96135 WP_001196362.1.96148 WP_001196362.1.96228 WP_001196362.1.96255 WP_001196362.1.96283 WP_001196362.1.96297 WP_001196362.1.96312 WP_001196362.1.96314 WP_001196362.1.96322 WP_001196362.1.96334 WP_001196362.1.96362 WP_001196362.1.96433 WP_001196362.1.96472 WP_001196362.1.9650 WP_001196362.1.96535 WP_001196362.1.96538 WP_001196362.1.96554 WP_001196362.1.96566 WP_001196362.1.96591 WP_001196362.1.96603 WP_001196362.1.96678 WP_001196362.1.96699 WP_001196362.1.96705 WP_001196362.1.9675 WP_001196362.1.96780 WP_001196362.1.96836 WP_001196362.1.96855 WP_001196362.1.96859 WP_001196362.1.96922 WP_001196362.1.96965 WP_001196362.1.96969 WP_001196362.1.96985 WP_001196362.1.96997 WP_001196362.1.97000 WP_001196362.1.97014 WP_001196362.1.97029 WP_001196362.1.97034 WP_001196362.1.97141 WP_001196362.1.97161 WP_001196362.1.97164 WP_001196362.1.97205 WP_001196362.1.97228 WP_001196362.1.97230 WP_001196362.1.97241 WP_001196362.1.97312 WP_001196362.1.97336 WP_001196362.1.97348 WP_001196362.1.97352 WP_001196362.1.97355 WP_001196362.1.97367 WP_001196362.1.9737 WP_001196362.1.97392 WP_001196362.1.97427 WP_001196362.1.97450 WP_001196362.1.97456 WP_001196362.1.97494 WP_001196362.1.97530 WP_001196362.1.97531 WP_001196362.1.97537 WP_001196362.1.97576 WP_001196362.1.97585 WP_001196362.1.97664 WP_001196362.1.97687 WP_001196362.1.97696 WP_001196362.1.97699 WP_001196362.1.97744 WP_001196362.1.97746 WP_001196362.1.97762 WP_001196362.1.9788 WP_001196362.1.97935 WP_001196362.1.97955 WP_001196362.1.97974 WP_001196362.1.97997 WP_001196362.1.98054 WP_001196362.1.98058 WP_001196362.1.98073 WP_001196362.1.98161 WP_001196362.1.98174 WP_001196362.1.98179 WP_001196362.1.98195 WP_001196362.1.98233 WP_001196362.1.98248 WP_001196362.1.98249 WP_001196362.1.98281 WP_001196362.1.98295 WP_001196362.1.98328 WP_001196362.1.98352 WP_001196362.1.98353 WP_001196362.1.98366 WP_001196362.1.98387 WP_001196362.1.98409 WP_001196362.1.98425 WP_001196362.1.98585 WP_001196362.1.98609 WP_001196362.1.98659 WP_001196362.1.98667 WP_001196362.1.9872 WP_001196362.1.98723 WP_001196362.1.98730 WP_001196362.1.98734 WP_001196362.1.98741 WP_001196362.1.98750 WP_001196362.1.98786 WP_001196362.1.98797 WP_001196362.1.98821 WP_001196362.1.98842 WP_001196362.1.98880 WP_001196362.1.98883 WP_001196362.1.98894 WP_001196362.1.98978 WP_001196362.1.98985 WP_001196362.1.9910 WP_001196362.1.99136 WP_001196362.1.99207 WP_001196362.1.99283 WP_001196362.1.99308 WP_001196362.1.99414 WP_001196362.1.99418 WP_001196362.1.99509 WP_001196362.1.99523 WP_001196362.1.9965 WP_001196362.1.99683 WP_001196362.1.99830 WP_001196362.1.99849 WP_001196362.1.99859 WP_001196362.1.99884 WP_001196362.1.99954 WP_001196362.1.99955 WP_001196362.1.99984 WP_001196362.1.99999 gi|470197485|ref|YP_007583886.1| gi|156980083|ref|YP_001442342.1| gi|15924756|ref|NP_372290.1| gi|470219222|ref|YP_007619616.1| gi|470199453|ref|YP_007585853.1| 158878.SAV1766 158879.SA1585 359786.SaurJH9_1819 359787.SaurJH1_1854 418127.SAHV_1752 681288.SAAV_1776 gi|148268242|ref|YP_001247185.1| gi|15927341|ref|NP_374874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]