SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150394946|ref|YP_001317621.1| from Staphylococcus aureus subsp. aureus JH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150394946|ref|YP_001317621.1|
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.86e-17
Family Rob transcription factor, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150394946|ref|YP_001317621.1|
Sequence length 157
Comment hypothetical protein SaurJH1_2510 [Staphylococcus aureus subsp. aureus JH1]
Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGL
CIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYI
HQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG
Download sequence
Identical sequences A0A0H3JRN6 A0A0H3K0Y5 A0A1Q4GXM2
gi|156980750|ref|YP_001443009.1| gi|148268871|ref|YP_001247814.1| gi|269204068|ref|YP_003283337.1| 399559 WP_000456486.1.10014 WP_000456486.1.100171 WP_000456486.1.100184 WP_000456486.1.100235 WP_000456486.1.100335 WP_000456486.1.100366 WP_000456486.1.100399 WP_000456486.1.10046 WP_000456486.1.100464 WP_000456486.1.10050 WP_000456486.1.100535 WP_000456486.1.100562 WP_000456486.1.100582 WP_000456486.1.100596 WP_000456486.1.100693 WP_000456486.1.100699 WP_000456486.1.100704 WP_000456486.1.100719 WP_000456486.1.100823 WP_000456486.1.100832 WP_000456486.1.100860 WP_000456486.1.100888 WP_000456486.1.100934 WP_000456486.1.10097 WP_000456486.1.101002 WP_000456486.1.101019 WP_000456486.1.101027 WP_000456486.1.101068 WP_000456486.1.101071 WP_000456486.1.101072 WP_000456486.1.101103 WP_000456486.1.10111 WP_000456486.1.101160 WP_000456486.1.101192 WP_000456486.1.101262 WP_000456486.1.101379 WP_000456486.1.101414 WP_000456486.1.101440 WP_000456486.1.101441 WP_000456486.1.10148 WP_000456486.1.101511 WP_000456486.1.101567 WP_000456486.1.10165 WP_000456486.1.101661 WP_000456486.1.101691 WP_000456486.1.101704 WP_000456486.1.101728 WP_000456486.1.101745 WP_000456486.1.101778 WP_000456486.1.101813 WP_000456486.1.101820 WP_000456486.1.101825 WP_000456486.1.101852 WP_000456486.1.101902 WP_000456486.1.101906 WP_000456486.1.101943 WP_000456486.1.102065 WP_000456486.1.102096 WP_000456486.1.102123 WP_000456486.1.102130 WP_000456486.1.102132 WP_000456486.1.10238 WP_000456486.1.1025 WP_000456486.1.10274 WP_000456486.1.1031 WP_000456486.1.10343 WP_000456486.1.1043 WP_000456486.1.10436 WP_000456486.1.10478 WP_000456486.1.10481 WP_000456486.1.10526 WP_000456486.1.10624 WP_000456486.1.10749 WP_000456486.1.10751 WP_000456486.1.1077 WP_000456486.1.10823 WP_000456486.1.10858 WP_000456486.1.10919 WP_000456486.1.10942 WP_000456486.1.10976 WP_000456486.1.10979 WP_000456486.1.11001 WP_000456486.1.11069 WP_000456486.1.11073 WP_000456486.1.11083 WP_000456486.1.11084 WP_000456486.1.1115 WP_000456486.1.11162 WP_000456486.1.11220 WP_000456486.1.11261 WP_000456486.1.11282 WP_000456486.1.11286 WP_000456486.1.11322 WP_000456486.1.11333 WP_000456486.1.11378 WP_000456486.1.11403 WP_000456486.1.11447 WP_000456486.1.11451 WP_000456486.1.1147 WP_000456486.1.11504 WP_000456486.1.11513 WP_000456486.1.11556 WP_000456486.1.11611 WP_000456486.1.11640 WP_000456486.1.11646 WP_000456486.1.11663 WP_000456486.1.1171 WP_000456486.1.11730 WP_000456486.1.11736 WP_000456486.1.11768 WP_000456486.1.11794 WP_000456486.1.11837 WP_000456486.1.11884 WP_000456486.1.11903 WP_000456486.1.12019 WP_000456486.1.12042 WP_000456486.1.1210 WP_000456486.1.12149 WP_000456486.1.12152 WP_000456486.1.12170 WP_000456486.1.12175 WP_000456486.1.12234 WP_000456486.1.12256 WP_000456486.1.12330 WP_000456486.1.12437 WP_000456486.1.12508 WP_000456486.1.1257 WP_000456486.1.12598 WP_000456486.1.12608 WP_000456486.1.12618 WP_000456486.1.12685 WP_000456486.1.12733 WP_000456486.1.12737 WP_000456486.1.12770 WP_000456486.1.12780 WP_000456486.1.12788 WP_000456486.1.12829 WP_000456486.1.12858 WP_000456486.1.12884 WP_000456486.1.12904 WP_000456486.1.12918 WP_000456486.1.12920 WP_000456486.1.13154 WP_000456486.1.13169 WP_000456486.1.13189 WP_000456486.1.13243 WP_000456486.1.13250 WP_000456486.1.13326 WP_000456486.1.13355 WP_000456486.1.13379 WP_000456486.1.13448 WP_000456486.1.13514 WP_000456486.1.13554 WP_000456486.1.13612 WP_000456486.1.13665 WP_000456486.1.13668 WP_000456486.1.13670 WP_000456486.1.13879 WP_000456486.1.13897 WP_000456486.1.13986 WP_000456486.1.13987 WP_000456486.1.14025 WP_000456486.1.14097 WP_000456486.1.14143 WP_000456486.1.14163 WP_000456486.1.1420 WP_000456486.1.14201 WP_000456486.1.1425 WP_000456486.1.1429 WP_000456486.1.14305 WP_000456486.1.14342 WP_000456486.1.14358 WP_000456486.1.14397 WP_000456486.1.14412 WP_000456486.1.14535 WP_000456486.1.14577 WP_000456486.1.14596 WP_000456486.1.14639 WP_000456486.1.14696 WP_000456486.1.1471 WP_000456486.1.14729 WP_000456486.1.14734 WP_000456486.1.14774 WP_000456486.1.14825 WP_000456486.1.14846 WP_000456486.1.14874 WP_000456486.1.14967 WP_000456486.1.14970 WP_000456486.1.15015 WP_000456486.1.15029 WP_000456486.1.15108 WP_000456486.1.15173 WP_000456486.1.15185 WP_000456486.1.1520 WP_000456486.1.15201 WP_000456486.1.1525 WP_000456486.1.15268 WP_000456486.1.15269 WP_000456486.1.15294 WP_000456486.1.15296 WP_000456486.1.15421 WP_000456486.1.15533 WP_000456486.1.15544 WP_000456486.1.15546 WP_000456486.1.1558 WP_000456486.1.15590 WP_000456486.1.1564 WP_000456486.1.15691 WP_000456486.1.15722 WP_000456486.1.15785 WP_000456486.1.15812 WP_000456486.1.159 WP_000456486.1.15920 WP_000456486.1.15921 WP_000456486.1.15925 WP_000456486.1.16018 WP_000456486.1.16068 WP_000456486.1.16096 WP_000456486.1.16098 WP_000456486.1.16140 WP_000456486.1.16195 WP_000456486.1.16203 WP_000456486.1.16223 WP_000456486.1.1623 WP_000456486.1.16251 WP_000456486.1.16265 WP_000456486.1.16276 WP_000456486.1.16311 WP_000456486.1.16395 WP_000456486.1.16407 WP_000456486.1.16589 WP_000456486.1.16632 WP_000456486.1.16639 WP_000456486.1.1665 WP_000456486.1.16651 WP_000456486.1.16653 WP_000456486.1.16693 WP_000456486.1.16747 WP_000456486.1.16761 WP_000456486.1.16794 WP_000456486.1.16815 WP_000456486.1.16824 WP_000456486.1.16880 WP_000456486.1.16882 WP_000456486.1.16920 WP_000456486.1.16925 WP_000456486.1.16969 WP_000456486.1.17080 WP_000456486.1.17122 WP_000456486.1.17132 WP_000456486.1.17139 WP_000456486.1.17157 WP_000456486.1.17180 WP_000456486.1.17240 WP_000456486.1.1729 WP_000456486.1.17309 WP_000456486.1.17327 WP_000456486.1.1736 WP_000456486.1.1741 WP_000456486.1.17419 WP_000456486.1.17454 WP_000456486.1.17529 WP_000456486.1.17531 WP_000456486.1.1756 WP_000456486.1.17590 WP_000456486.1.17643 WP_000456486.1.1765 WP_000456486.1.17671 WP_000456486.1.17717 WP_000456486.1.17718 WP_000456486.1.17725 WP_000456486.1.17737 WP_000456486.1.17796 WP_000456486.1.17818 WP_000456486.1.17832 WP_000456486.1.17847 WP_000456486.1.17853 WP_000456486.1.17909 WP_000456486.1.17943 WP_000456486.1.17987 WP_000456486.1.18011 WP_000456486.1.18069 WP_000456486.1.18080 WP_000456486.1.18113 WP_000456486.1.18140 WP_000456486.1.18153 WP_000456486.1.18203 WP_000456486.1.18237 WP_000456486.1.18248 WP_000456486.1.18261 WP_000456486.1.18288 WP_000456486.1.1829 WP_000456486.1.18301 WP_000456486.1.18309 WP_000456486.1.18310 WP_000456486.1.18360 WP_000456486.1.18412 WP_000456486.1.18429 WP_000456486.1.1847 WP_000456486.1.18487 WP_000456486.1.18506 WP_000456486.1.18507 WP_000456486.1.18539 WP_000456486.1.18560 WP_000456486.1.18570 WP_000456486.1.18591 WP_000456486.1.18632 WP_000456486.1.18679 WP_000456486.1.18741 WP_000456486.1.18777 WP_000456486.1.18792 WP_000456486.1.18818 WP_000456486.1.18819 WP_000456486.1.18834 WP_000456486.1.18882 WP_000456486.1.1892 WP_000456486.1.18965 WP_000456486.1.18974 WP_000456486.1.18996 WP_000456486.1.19052 WP_000456486.1.19082 WP_000456486.1.1911 WP_000456486.1.19301 WP_000456486.1.19322 WP_000456486.1.19430 WP_000456486.1.19450 WP_000456486.1.19537 WP_000456486.1.19555 WP_000456486.1.19577 WP_000456486.1.19611 WP_000456486.1.1964 WP_000456486.1.19643 WP_000456486.1.19701 WP_000456486.1.19725 WP_000456486.1.19732 WP_000456486.1.1974 WP_000456486.1.19748 WP_000456486.1.19792 WP_000456486.1.19816 WP_000456486.1.19848 WP_000456486.1.19891 WP_000456486.1.19912 WP_000456486.1.19921 WP_000456486.1.19980 WP_000456486.1.19981 WP_000456486.1.19982 WP_000456486.1.20006 WP_000456486.1.20049 WP_000456486.1.20052 WP_000456486.1.2007 WP_000456486.1.20078 WP_000456486.1.20090 WP_000456486.1.20100 WP_000456486.1.20156 WP_000456486.1.20161 WP_000456486.1.20167 WP_000456486.1.20191 WP_000456486.1.20214 WP_000456486.1.20245 WP_000456486.1.2029 WP_000456486.1.20324 WP_000456486.1.20340 WP_000456486.1.20394 WP_000456486.1.20398 WP_000456486.1.20399 WP_000456486.1.20411 WP_000456486.1.20447 WP_000456486.1.20479 WP_000456486.1.20487 WP_000456486.1.20574 WP_000456486.1.20579 WP_000456486.1.20585 WP_000456486.1.20611 WP_000456486.1.20619 WP_000456486.1.20620 WP_000456486.1.20736 WP_000456486.1.20796 WP_000456486.1.20821 WP_000456486.1.20846 WP_000456486.1.20867 WP_000456486.1.20878 WP_000456486.1.20913 WP_000456486.1.20922 WP_000456486.1.20935 WP_000456486.1.20939 WP_000456486.1.20945 WP_000456486.1.20971 WP_000456486.1.21009 WP_000456486.1.21056 WP_000456486.1.21066 WP_000456486.1.21078 WP_000456486.1.21109 WP_000456486.1.21111 WP_000456486.1.21154 WP_000456486.1.21183 WP_000456486.1.2119 WP_000456486.1.21257 WP_000456486.1.21272 WP_000456486.1.21313 WP_000456486.1.21339 WP_000456486.1.2135 WP_000456486.1.21359 WP_000456486.1.21375 WP_000456486.1.21379 WP_000456486.1.21393 WP_000456486.1.21412 WP_000456486.1.21449 WP_000456486.1.21464 WP_000456486.1.21480 WP_000456486.1.21500 WP_000456486.1.21514 WP_000456486.1.21572 WP_000456486.1.2159 WP_000456486.1.2160 WP_000456486.1.21636 WP_000456486.1.21724 WP_000456486.1.21746 WP_000456486.1.21763 WP_000456486.1.21787 WP_000456486.1.21830 WP_000456486.1.21988 WP_000456486.1.22027 WP_000456486.1.22082 WP_000456486.1.22111 WP_000456486.1.22177 WP_000456486.1.22197 WP_000456486.1.22227 WP_000456486.1.22302 WP_000456486.1.22400 WP_000456486.1.22493 WP_000456486.1.22533 WP_000456486.1.22559 WP_000456486.1.22650 WP_000456486.1.22696 WP_000456486.1.22702 WP_000456486.1.22709 WP_000456486.1.22738 WP_000456486.1.22789 WP_000456486.1.22790 WP_000456486.1.22792 WP_000456486.1.22803 WP_000456486.1.22853 WP_000456486.1.22869 WP_000456486.1.22890 WP_000456486.1.22969 WP_000456486.1.23008 WP_000456486.1.23061 WP_000456486.1.23082 WP_000456486.1.23103 WP_000456486.1.23121 WP_000456486.1.23130 WP_000456486.1.23132 WP_000456486.1.23133 WP_000456486.1.23161 WP_000456486.1.23185 WP_000456486.1.23244 WP_000456486.1.2327 WP_000456486.1.23275 WP_000456486.1.23288 WP_000456486.1.23413 WP_000456486.1.23449 WP_000456486.1.23531 WP_000456486.1.23572 WP_000456486.1.23630 WP_000456486.1.23644 WP_000456486.1.23690 WP_000456486.1.23740 WP_000456486.1.23796 WP_000456486.1.23809 WP_000456486.1.23842 WP_000456486.1.2389 WP_000456486.1.23900 WP_000456486.1.23944 WP_000456486.1.23956 WP_000456486.1.23972 WP_000456486.1.23995 WP_000456486.1.24000 WP_000456486.1.24129 WP_000456486.1.24174 WP_000456486.1.24207 WP_000456486.1.24213 WP_000456486.1.24263 WP_000456486.1.2427 WP_000456486.1.24277 WP_000456486.1.24343 WP_000456486.1.24416 WP_000456486.1.24437 WP_000456486.1.24469 WP_000456486.1.2450 WP_000456486.1.24589 WP_000456486.1.24596 WP_000456486.1.24602 WP_000456486.1.24631 WP_000456486.1.24679 WP_000456486.1.24823 WP_000456486.1.24855 WP_000456486.1.2497 WP_000456486.1.25007 WP_000456486.1.2501 WP_000456486.1.25012 WP_000456486.1.2506 WP_000456486.1.25070 WP_000456486.1.25092 WP_000456486.1.25098 WP_000456486.1.25115 WP_000456486.1.25145 WP_000456486.1.25167 WP_000456486.1.25287 WP_000456486.1.25361 WP_000456486.1.25459 WP_000456486.1.25489 WP_000456486.1.2552 WP_000456486.1.25557 WP_000456486.1.25595 WP_000456486.1.25621 WP_000456486.1.25623 WP_000456486.1.25721 WP_000456486.1.25758 WP_000456486.1.25779 WP_000456486.1.25802 WP_000456486.1.25840 WP_000456486.1.25856 WP_000456486.1.25857 WP_000456486.1.2590 WP_000456486.1.25910 WP_000456486.1.25930 WP_000456486.1.26039 WP_000456486.1.2608 WP_000456486.1.26086 WP_000456486.1.26106 WP_000456486.1.26143 WP_000456486.1.26169 WP_000456486.1.2621 WP_000456486.1.26255 WP_000456486.1.26266 WP_000456486.1.26276 WP_000456486.1.26290 WP_000456486.1.26298 WP_000456486.1.26314 WP_000456486.1.26318 WP_000456486.1.26340 WP_000456486.1.26345 WP_000456486.1.26346 WP_000456486.1.26354 WP_000456486.1.26359 WP_000456486.1.26364 WP_000456486.1.26399 WP_000456486.1.26404 WP_000456486.1.2643 WP_000456486.1.26506 WP_000456486.1.26662 WP_000456486.1.26677 WP_000456486.1.26692 WP_000456486.1.2673 WP_000456486.1.26751 WP_000456486.1.26772 WP_000456486.1.26804 WP_000456486.1.2684 WP_000456486.1.26840 WP_000456486.1.26865 WP_000456486.1.26884 WP_000456486.1.2689 WP_000456486.1.26903 WP_000456486.1.26905 WP_000456486.1.26938 WP_000456486.1.26944 WP_000456486.1.27013 WP_000456486.1.27053 WP_000456486.1.27083 WP_000456486.1.27166 WP_000456486.1.27170 WP_000456486.1.2718 WP_000456486.1.27182 WP_000456486.1.2719 WP_000456486.1.27262 WP_000456486.1.27293 WP_000456486.1.27294 WP_000456486.1.27323 WP_000456486.1.27379 WP_000456486.1.27387 WP_000456486.1.27447 WP_000456486.1.27456 WP_000456486.1.27468 WP_000456486.1.2753 WP_000456486.1.27539 WP_000456486.1.27590 WP_000456486.1.27628 WP_000456486.1.27646 WP_000456486.1.27689 WP_000456486.1.27739 WP_000456486.1.27744 WP_000456486.1.27765 WP_000456486.1.27793 WP_000456486.1.27830 WP_000456486.1.2795 WP_000456486.1.28016 WP_000456486.1.28091 WP_000456486.1.28105 WP_000456486.1.28173 WP_000456486.1.28213 WP_000456486.1.28226 WP_000456486.1.28230 WP_000456486.1.28253 WP_000456486.1.28257 WP_000456486.1.28274 WP_000456486.1.28315 WP_000456486.1.28319 WP_000456486.1.28347 WP_000456486.1.28400 WP_000456486.1.28430 WP_000456486.1.2852 WP_000456486.1.28578 WP_000456486.1.28580 WP_000456486.1.28605 WP_000456486.1.28720 WP_000456486.1.28763 WP_000456486.1.28784 WP_000456486.1.28785 WP_000456486.1.28871 WP_000456486.1.28909 WP_000456486.1.28981 WP_000456486.1.28987 WP_000456486.1.29052 WP_000456486.1.29060 WP_000456486.1.29112 WP_000456486.1.29155 WP_000456486.1.29166 WP_000456486.1.29187 WP_000456486.1.29226 WP_000456486.1.29242 WP_000456486.1.29263 WP_000456486.1.29276 WP_000456486.1.29329 WP_000456486.1.29366 WP_000456486.1.29368 WP_000456486.1.29395 WP_000456486.1.29420 WP_000456486.1.29468 WP_000456486.1.29522 WP_000456486.1.2957 WP_000456486.1.2972 WP_000456486.1.29736 WP_000456486.1.29744 WP_000456486.1.29788 WP_000456486.1.2981 WP_000456486.1.29862 WP_000456486.1.29902 WP_000456486.1.29905 WP_000456486.1.29918 WP_000456486.1.29981 WP_000456486.1.30051 WP_000456486.1.30089 WP_000456486.1.30095 WP_000456486.1.30100 WP_000456486.1.30197 WP_000456486.1.30204 WP_000456486.1.30209 WP_000456486.1.30249 WP_000456486.1.30268 WP_000456486.1.30302 WP_000456486.1.30307 WP_000456486.1.30328 WP_000456486.1.30364 WP_000456486.1.30508 WP_000456486.1.30531 WP_000456486.1.30560 WP_000456486.1.30622 WP_000456486.1.30645 WP_000456486.1.30646 WP_000456486.1.30666 WP_000456486.1.30702 WP_000456486.1.30720 WP_000456486.1.30726 WP_000456486.1.30763 WP_000456486.1.3077 WP_000456486.1.30845 WP_000456486.1.30847 WP_000456486.1.30854 WP_000456486.1.30911 WP_000456486.1.31005 WP_000456486.1.31022 WP_000456486.1.31039 WP_000456486.1.31048 WP_000456486.1.31176 WP_000456486.1.31206 WP_000456486.1.3123 WP_000456486.1.31315 WP_000456486.1.31337 WP_000456486.1.31339 WP_000456486.1.31355 WP_000456486.1.31437 WP_000456486.1.31442 WP_000456486.1.31479 WP_000456486.1.31529 WP_000456486.1.31539 WP_000456486.1.31642 WP_000456486.1.31647 WP_000456486.1.31653 WP_000456486.1.31686 WP_000456486.1.31753 WP_000456486.1.31827 WP_000456486.1.31828 WP_000456486.1.31842 WP_000456486.1.31892 WP_000456486.1.31931 WP_000456486.1.31997 WP_000456486.1.32003 WP_000456486.1.32029 WP_000456486.1.32067 WP_000456486.1.32160 WP_000456486.1.32207 WP_000456486.1.3229 WP_000456486.1.32339 WP_000456486.1.3242 WP_000456486.1.32474 WP_000456486.1.32481 WP_000456486.1.32483 WP_000456486.1.32514 WP_000456486.1.32565 WP_000456486.1.32607 WP_000456486.1.32634 WP_000456486.1.32645 WP_000456486.1.32746 WP_000456486.1.32764 WP_000456486.1.32770 WP_000456486.1.32800 WP_000456486.1.32928 WP_000456486.1.32939 WP_000456486.1.32954 WP_000456486.1.33038 WP_000456486.1.33048 WP_000456486.1.33110 WP_000456486.1.33123 WP_000456486.1.33138 WP_000456486.1.33212 WP_000456486.1.33250 WP_000456486.1.33266 WP_000456486.1.33296 WP_000456486.1.33335 WP_000456486.1.33357 WP_000456486.1.3342 WP_000456486.1.33432 WP_000456486.1.33468 WP_000456486.1.3347 WP_000456486.1.33507 WP_000456486.1.33594 WP_000456486.1.33626 WP_000456486.1.33627 WP_000456486.1.3363 WP_000456486.1.33654 WP_000456486.1.33692 WP_000456486.1.33695 WP_000456486.1.33718 WP_000456486.1.33735 WP_000456486.1.33743 WP_000456486.1.33769 WP_000456486.1.33792 WP_000456486.1.33804 WP_000456486.1.33813 WP_000456486.1.33968 WP_000456486.1.33971 WP_000456486.1.33983 WP_000456486.1.34026 WP_000456486.1.34030 WP_000456486.1.34051 WP_000456486.1.34062 WP_000456486.1.34100 WP_000456486.1.34132 WP_000456486.1.34182 WP_000456486.1.34209 WP_000456486.1.34244 WP_000456486.1.34250 WP_000456486.1.34251 WP_000456486.1.34285 WP_000456486.1.34381 WP_000456486.1.34403 WP_000456486.1.34410 WP_000456486.1.34482 WP_000456486.1.34492 WP_000456486.1.34502 WP_000456486.1.34510 WP_000456486.1.34526 WP_000456486.1.3461 WP_000456486.1.34677 WP_000456486.1.34737 WP_000456486.1.34767 WP_000456486.1.34818 WP_000456486.1.34890 WP_000456486.1.34918 WP_000456486.1.34998 WP_000456486.1.35059 WP_000456486.1.35062 WP_000456486.1.35089 WP_000456486.1.35097 WP_000456486.1.35110 WP_000456486.1.35121 WP_000456486.1.35233 WP_000456486.1.35276 WP_000456486.1.35297 WP_000456486.1.35334 WP_000456486.1.35342 WP_000456486.1.354 WP_000456486.1.35415 WP_000456486.1.3547 WP_000456486.1.35498 WP_000456486.1.35525 WP_000456486.1.35580 WP_000456486.1.35615 WP_000456486.1.35623 WP_000456486.1.35673 WP_000456486.1.3569 WP_000456486.1.35801 WP_000456486.1.35826 WP_000456486.1.35900 WP_000456486.1.35928 WP_000456486.1.35950 WP_000456486.1.36004 WP_000456486.1.36082 WP_000456486.1.36102 WP_000456486.1.36119 WP_000456486.1.36141 WP_000456486.1.3617 WP_000456486.1.36187 WP_000456486.1.36188 WP_000456486.1.36250 WP_000456486.1.36264 WP_000456486.1.36278 WP_000456486.1.36282 WP_000456486.1.36307 WP_000456486.1.36344 WP_000456486.1.36389 WP_000456486.1.36532 WP_000456486.1.36535 WP_000456486.1.3655 WP_000456486.1.36570 WP_000456486.1.36580 WP_000456486.1.36600 WP_000456486.1.36615 WP_000456486.1.36646 WP_000456486.1.3666 WP_000456486.1.36689 WP_000456486.1.36697 WP_000456486.1.36745 WP_000456486.1.3675 WP_000456486.1.36783 WP_000456486.1.36796 WP_000456486.1.36822 WP_000456486.1.3685 WP_000456486.1.36858 WP_000456486.1.3687 WP_000456486.1.36955 WP_000456486.1.36979 WP_000456486.1.36980 WP_000456486.1.36997 WP_000456486.1.37002 WP_000456486.1.37016 WP_000456486.1.3703 WP_000456486.1.37044 WP_000456486.1.37055 WP_000456486.1.37080 WP_000456486.1.37121 WP_000456486.1.37134 WP_000456486.1.37220 WP_000456486.1.37341 WP_000456486.1.37398 WP_000456486.1.37424 WP_000456486.1.37467 WP_000456486.1.37503 WP_000456486.1.37583 WP_000456486.1.37602 WP_000456486.1.37605 WP_000456486.1.37621 WP_000456486.1.37624 WP_000456486.1.3776 WP_000456486.1.37781 WP_000456486.1.37815 WP_000456486.1.37828 WP_000456486.1.37953 WP_000456486.1.37987 WP_000456486.1.38038 WP_000456486.1.38057 WP_000456486.1.38070 WP_000456486.1.38082 WP_000456486.1.3809 WP_000456486.1.38160 WP_000456486.1.38177 WP_000456486.1.3820 WP_000456486.1.38230 WP_000456486.1.38232 WP_000456486.1.38276 WP_000456486.1.38282 WP_000456486.1.38309 WP_000456486.1.38339 WP_000456486.1.38383 WP_000456486.1.3842 WP_000456486.1.38437 WP_000456486.1.38453 WP_000456486.1.38493 WP_000456486.1.38522 WP_000456486.1.38546 WP_000456486.1.38607 WP_000456486.1.38612 WP_000456486.1.3867 WP_000456486.1.38674 WP_000456486.1.38721 WP_000456486.1.38760 WP_000456486.1.38823 WP_000456486.1.38841 WP_000456486.1.38858 WP_000456486.1.38926 WP_000456486.1.38931 WP_000456486.1.38940 WP_000456486.1.38941 WP_000456486.1.38972 WP_000456486.1.38989 WP_000456486.1.390 WP_000456486.1.39012 WP_000456486.1.39014 WP_000456486.1.39043 WP_000456486.1.39053 WP_000456486.1.3906 WP_000456486.1.391 WP_000456486.1.39108 WP_000456486.1.39203 WP_000456486.1.39206 WP_000456486.1.39217 WP_000456486.1.3926 WP_000456486.1.39272 WP_000456486.1.39290 WP_000456486.1.39332 WP_000456486.1.39333 WP_000456486.1.39397 WP_000456486.1.39406 WP_000456486.1.39486 WP_000456486.1.39506 WP_000456486.1.39550 WP_000456486.1.39645 WP_000456486.1.39687 WP_000456486.1.39689 WP_000456486.1.39697 WP_000456486.1.39711 WP_000456486.1.39738 WP_000456486.1.39767 WP_000456486.1.39789 WP_000456486.1.39832 WP_000456486.1.39838 WP_000456486.1.39856 WP_000456486.1.39869 WP_000456486.1.40014 WP_000456486.1.40043 WP_000456486.1.40099 WP_000456486.1.40120 WP_000456486.1.40137 WP_000456486.1.40164 WP_000456486.1.40173 WP_000456486.1.4019 WP_000456486.1.40318 WP_000456486.1.40320 WP_000456486.1.40330 WP_000456486.1.40342 WP_000456486.1.40368 WP_000456486.1.4045 WP_000456486.1.40472 WP_000456486.1.40474 WP_000456486.1.40481 WP_000456486.1.40505 WP_000456486.1.40531 WP_000456486.1.40532 WP_000456486.1.4056 WP_000456486.1.40579 WP_000456486.1.40588 WP_000456486.1.40620 WP_000456486.1.40644 WP_000456486.1.40655 WP_000456486.1.40658 WP_000456486.1.40659 WP_000456486.1.40760 WP_000456486.1.40797 WP_000456486.1.40816 WP_000456486.1.41064 WP_000456486.1.41084 WP_000456486.1.41094 WP_000456486.1.41119 WP_000456486.1.41129 WP_000456486.1.4115 WP_000456486.1.41178 WP_000456486.1.41208 WP_000456486.1.41241 WP_000456486.1.41255 WP_000456486.1.41289 WP_000456486.1.4129 WP_000456486.1.41426 WP_000456486.1.41432 WP_000456486.1.41433 WP_000456486.1.41499 WP_000456486.1.41558 WP_000456486.1.41567 WP_000456486.1.41582 WP_000456486.1.41674 WP_000456486.1.41839 WP_000456486.1.4188 WP_000456486.1.41898 WP_000456486.1.41935 WP_000456486.1.41943 WP_000456486.1.41989 WP_000456486.1.420 WP_000456486.1.42015 WP_000456486.1.42017 WP_000456486.1.42028 WP_000456486.1.42087 WP_000456486.1.42125 WP_000456486.1.42269 WP_000456486.1.42305 WP_000456486.1.42355 WP_000456486.1.42403 WP_000456486.1.42436 WP_000456486.1.42459 WP_000456486.1.42481 WP_000456486.1.42510 WP_000456486.1.42593 WP_000456486.1.426 WP_000456486.1.42640 WP_000456486.1.42652 WP_000456486.1.42668 WP_000456486.1.42674 WP_000456486.1.42737 WP_000456486.1.42759 WP_000456486.1.42786 WP_000456486.1.42837 WP_000456486.1.4293 WP_000456486.1.4299 WP_000456486.1.43014 WP_000456486.1.43047 WP_000456486.1.43072 WP_000456486.1.43122 WP_000456486.1.43131 WP_000456486.1.43134 WP_000456486.1.43143 WP_000456486.1.43147 WP_000456486.1.43159 WP_000456486.1.43165 WP_000456486.1.43202 WP_000456486.1.43232 WP_000456486.1.43248 WP_000456486.1.4325 WP_000456486.1.43263 WP_000456486.1.4327 WP_000456486.1.43341 WP_000456486.1.43349 WP_000456486.1.43369 WP_000456486.1.4337 WP_000456486.1.43406 WP_000456486.1.4341 WP_000456486.1.43460 WP_000456486.1.4347 WP_000456486.1.43550 WP_000456486.1.43560 WP_000456486.1.43617 WP_000456486.1.43627 WP_000456486.1.43659 WP_000456486.1.43670 WP_000456486.1.43702 WP_000456486.1.43703 WP_000456486.1.4372 WP_000456486.1.43731 WP_000456486.1.43752 WP_000456486.1.43788 WP_000456486.1.43819 WP_000456486.1.43827 WP_000456486.1.4385 WP_000456486.1.43904 WP_000456486.1.43915 WP_000456486.1.44119 WP_000456486.1.44153 WP_000456486.1.44181 WP_000456486.1.44195 WP_000456486.1.44265 WP_000456486.1.44302 WP_000456486.1.44388 WP_000456486.1.44396 WP_000456486.1.44405 WP_000456486.1.44420 WP_000456486.1.44544 WP_000456486.1.44579 WP_000456486.1.44588 WP_000456486.1.44605 WP_000456486.1.44631 WP_000456486.1.44672 WP_000456486.1.44732 WP_000456486.1.44755 WP_000456486.1.44785 WP_000456486.1.44788 WP_000456486.1.44796 WP_000456486.1.44881 WP_000456486.1.44882 WP_000456486.1.44914 WP_000456486.1.44955 WP_000456486.1.44969 WP_000456486.1.45033 WP_000456486.1.45035 WP_000456486.1.45099 WP_000456486.1.4513 WP_000456486.1.45133 WP_000456486.1.45164 WP_000456486.1.45170 WP_000456486.1.45272 WP_000456486.1.45290 WP_000456486.1.45297 WP_000456486.1.453 WP_000456486.1.45364 WP_000456486.1.45431 WP_000456486.1.45439 WP_000456486.1.45472 WP_000456486.1.4550 WP_000456486.1.45507 WP_000456486.1.45560 WP_000456486.1.45577 WP_000456486.1.45670 WP_000456486.1.45703 WP_000456486.1.45734 WP_000456486.1.45768 WP_000456486.1.45771 WP_000456486.1.45780 WP_000456486.1.4584 WP_000456486.1.45852 WP_000456486.1.45897 WP_000456486.1.45954 WP_000456486.1.4598 WP_000456486.1.46003 WP_000456486.1.46005 WP_000456486.1.46055 WP_000456486.1.46087 WP_000456486.1.46168 WP_000456486.1.46208 WP_000456486.1.46222 WP_000456486.1.46228 WP_000456486.1.46276 WP_000456486.1.46330 WP_000456486.1.46334 WP_000456486.1.46368 WP_000456486.1.46380 WP_000456486.1.46389 WP_000456486.1.46401 WP_000456486.1.46422 WP_000456486.1.46465 WP_000456486.1.46543 WP_000456486.1.4662 WP_000456486.1.46660 WP_000456486.1.46664 WP_000456486.1.46670 WP_000456486.1.46692 WP_000456486.1.46702 WP_000456486.1.46703 WP_000456486.1.46752 WP_000456486.1.46765 WP_000456486.1.46852 WP_000456486.1.46881 WP_000456486.1.46908 WP_000456486.1.46925 WP_000456486.1.46937 WP_000456486.1.4696 WP_000456486.1.46983 WP_000456486.1.46995 WP_000456486.1.47051 WP_000456486.1.47128 WP_000456486.1.47153 WP_000456486.1.47159 WP_000456486.1.47163 WP_000456486.1.47187 WP_000456486.1.47211 WP_000456486.1.47216 WP_000456486.1.47258 WP_000456486.1.47269 WP_000456486.1.47279 WP_000456486.1.4728 WP_000456486.1.47290 WP_000456486.1.47294 WP_000456486.1.47306 WP_000456486.1.47328 WP_000456486.1.47381 WP_000456486.1.47399 WP_000456486.1.47406 WP_000456486.1.47426 WP_000456486.1.47432 WP_000456486.1.47560 WP_000456486.1.47618 WP_000456486.1.4767 WP_000456486.1.477 WP_000456486.1.47733 WP_000456486.1.47763 WP_000456486.1.47782 WP_000456486.1.47836 WP_000456486.1.47859 WP_000456486.1.47872 WP_000456486.1.47873 WP_000456486.1.47904 WP_000456486.1.47996 WP_000456486.1.48011 WP_000456486.1.48030 WP_000456486.1.48047 WP_000456486.1.4805 WP_000456486.1.48149 WP_000456486.1.4815 WP_000456486.1.48154 WP_000456486.1.48169 WP_000456486.1.48186 WP_000456486.1.48227 WP_000456486.1.48236 WP_000456486.1.48250 WP_000456486.1.48284 WP_000456486.1.48293 WP_000456486.1.48307 WP_000456486.1.48322 WP_000456486.1.48391 WP_000456486.1.48394 WP_000456486.1.48463 WP_000456486.1.48563 WP_000456486.1.48577 WP_000456486.1.48593 WP_000456486.1.48634 WP_000456486.1.48656 WP_000456486.1.4868 WP_000456486.1.48705 WP_000456486.1.48711 WP_000456486.1.48805 WP_000456486.1.48823 WP_000456486.1.48833 WP_000456486.1.48835 WP_000456486.1.4886 WP_000456486.1.48936 WP_000456486.1.48941 WP_000456486.1.48945 WP_000456486.1.48951 WP_000456486.1.48968 WP_000456486.1.48982 WP_000456486.1.48993 WP_000456486.1.4901 WP_000456486.1.4905 WP_000456486.1.49129 WP_000456486.1.49159 WP_000456486.1.4916 WP_000456486.1.49161 WP_000456486.1.4917 WP_000456486.1.4918 WP_000456486.1.49207 WP_000456486.1.49248 WP_000456486.1.49327 WP_000456486.1.49398 WP_000456486.1.4962 WP_000456486.1.49653 WP_000456486.1.49669 WP_000456486.1.49730 WP_000456486.1.49742 WP_000456486.1.4980 WP_000456486.1.49800 WP_000456486.1.49860 WP_000456486.1.49863 WP_000456486.1.49871 WP_000456486.1.4989 WP_000456486.1.49894 WP_000456486.1.49907 WP_000456486.1.49934 WP_000456486.1.4994 WP_000456486.1.49970 WP_000456486.1.49982 WP_000456486.1.50013 WP_000456486.1.50038 WP_000456486.1.50039 WP_000456486.1.50061 WP_000456486.1.50076 WP_000456486.1.5013 WP_000456486.1.50138 WP_000456486.1.50217 WP_000456486.1.50219 WP_000456486.1.50261 WP_000456486.1.50313 WP_000456486.1.50314 WP_000456486.1.50356 WP_000456486.1.50425 WP_000456486.1.50430 WP_000456486.1.50536 WP_000456486.1.50578 WP_000456486.1.50595 WP_000456486.1.50660 WP_000456486.1.50768 WP_000456486.1.50799 WP_000456486.1.50820 WP_000456486.1.50884 WP_000456486.1.50896 WP_000456486.1.50937 WP_000456486.1.50962 WP_000456486.1.5109 WP_000456486.1.5110 WP_000456486.1.5111 WP_000456486.1.51152 WP_000456486.1.51236 WP_000456486.1.51245 WP_000456486.1.51250 WP_000456486.1.51282 WP_000456486.1.51295 WP_000456486.1.51306 WP_000456486.1.51310 WP_000456486.1.51346 WP_000456486.1.51376 WP_000456486.1.51403 WP_000456486.1.51454 WP_000456486.1.51456 WP_000456486.1.51492 WP_000456486.1.515 WP_000456486.1.51527 WP_000456486.1.5155 WP_000456486.1.51559 WP_000456486.1.51575 WP_000456486.1.51590 WP_000456486.1.51665 WP_000456486.1.51716 WP_000456486.1.51748 WP_000456486.1.51797 WP_000456486.1.51836 WP_000456486.1.51842 WP_000456486.1.51844 WP_000456486.1.51871 WP_000456486.1.51883 WP_000456486.1.51924 WP_000456486.1.51936 WP_000456486.1.51952 WP_000456486.1.51971 WP_000456486.1.51995 WP_000456486.1.52078 WP_000456486.1.521 WP_000456486.1.5213 WP_000456486.1.52151 WP_000456486.1.52182 WP_000456486.1.52185 WP_000456486.1.52193 WP_000456486.1.52251 WP_000456486.1.52296 WP_000456486.1.523 WP_000456486.1.52322 WP_000456486.1.52327 WP_000456486.1.52331 WP_000456486.1.52340 WP_000456486.1.52440 WP_000456486.1.52442 WP_000456486.1.52463 WP_000456486.1.52518 WP_000456486.1.52548 WP_000456486.1.52595 WP_000456486.1.52623 WP_000456486.1.52624 WP_000456486.1.52645 WP_000456486.1.52687 WP_000456486.1.52699 WP_000456486.1.52715 WP_000456486.1.52722 WP_000456486.1.52848 WP_000456486.1.52877 WP_000456486.1.52878 WP_000456486.1.52941 WP_000456486.1.52947 WP_000456486.1.52984 WP_000456486.1.53002 WP_000456486.1.53071 WP_000456486.1.53140 WP_000456486.1.53153 WP_000456486.1.53178 WP_000456486.1.53209 WP_000456486.1.53260 WP_000456486.1.53317 WP_000456486.1.53319 WP_000456486.1.53394 WP_000456486.1.53403 WP_000456486.1.53432 WP_000456486.1.53462 WP_000456486.1.53521 WP_000456486.1.53577 WP_000456486.1.53641 WP_000456486.1.53648 WP_000456486.1.53671 WP_000456486.1.53766 WP_000456486.1.53827 WP_000456486.1.53835 WP_000456486.1.53889 WP_000456486.1.53915 WP_000456486.1.53934 WP_000456486.1.53969 WP_000456486.1.53999 WP_000456486.1.5401 WP_000456486.1.54022 WP_000456486.1.54109 WP_000456486.1.54147 WP_000456486.1.54229 WP_000456486.1.54297 WP_000456486.1.54395 WP_000456486.1.544 WP_000456486.1.54413 WP_000456486.1.54503 WP_000456486.1.54510 WP_000456486.1.54551 WP_000456486.1.54637 WP_000456486.1.54675 WP_000456486.1.5469 WP_000456486.1.54745 WP_000456486.1.54753 WP_000456486.1.54878 WP_000456486.1.54955 WP_000456486.1.55014 WP_000456486.1.5519 WP_000456486.1.55214 WP_000456486.1.55274 WP_000456486.1.55309 WP_000456486.1.55367 WP_000456486.1.55369 WP_000456486.1.55403 WP_000456486.1.55405 WP_000456486.1.55421 WP_000456486.1.55508 WP_000456486.1.5554 WP_000456486.1.55544 WP_000456486.1.55558 WP_000456486.1.5556 WP_000456486.1.55583 WP_000456486.1.5559 WP_000456486.1.55628 WP_000456486.1.55637 WP_000456486.1.55653 WP_000456486.1.557 WP_000456486.1.55728 WP_000456486.1.55784 WP_000456486.1.55786 WP_000456486.1.5580 WP_000456486.1.55818 WP_000456486.1.55831 WP_000456486.1.55835 WP_000456486.1.55867 WP_000456486.1.55886 WP_000456486.1.5589 WP_000456486.1.55904 WP_000456486.1.55916 WP_000456486.1.55933 WP_000456486.1.55953 WP_000456486.1.56000 WP_000456486.1.56025 WP_000456486.1.56048 WP_000456486.1.56078 WP_000456486.1.56098 WP_000456486.1.56225 WP_000456486.1.5623 WP_000456486.1.56239 WP_000456486.1.56281 WP_000456486.1.56332 WP_000456486.1.56333 WP_000456486.1.5635 WP_000456486.1.56400 WP_000456486.1.5644 WP_000456486.1.56558 WP_000456486.1.5658 WP_000456486.1.56598 WP_000456486.1.566 WP_000456486.1.56628 WP_000456486.1.56641 WP_000456486.1.56658 WP_000456486.1.5666 WP_000456486.1.5677 WP_000456486.1.56778 WP_000456486.1.56794 WP_000456486.1.56815 WP_000456486.1.56856 WP_000456486.1.5686 WP_000456486.1.56865 WP_000456486.1.56878 WP_000456486.1.569 WP_000456486.1.56986 WP_000456486.1.57073 WP_000456486.1.57075 WP_000456486.1.57097 WP_000456486.1.57109 WP_000456486.1.57170 WP_000456486.1.5718 WP_000456486.1.57190 WP_000456486.1.57214 WP_000456486.1.57265 WP_000456486.1.57309 WP_000456486.1.57445 WP_000456486.1.57481 WP_000456486.1.57594 WP_000456486.1.57650 WP_000456486.1.57665 WP_000456486.1.57682 WP_000456486.1.57692 WP_000456486.1.57730 WP_000456486.1.57734 WP_000456486.1.57754 WP_000456486.1.57808 WP_000456486.1.57819 WP_000456486.1.57837 WP_000456486.1.57840 WP_000456486.1.57861 WP_000456486.1.57878 WP_000456486.1.5791 WP_000456486.1.57943 WP_000456486.1.57952 WP_000456486.1.57974 WP_000456486.1.58016 WP_000456486.1.58035 WP_000456486.1.58049 WP_000456486.1.58074 WP_000456486.1.58116 WP_000456486.1.58127 WP_000456486.1.58148 WP_000456486.1.58158 WP_000456486.1.5816 WP_000456486.1.58277 WP_000456486.1.58317 WP_000456486.1.58352 WP_000456486.1.58364 WP_000456486.1.58395 WP_000456486.1.58430 WP_000456486.1.58435 WP_000456486.1.58512 WP_000456486.1.58530 WP_000456486.1.5857 WP_000456486.1.58571 WP_000456486.1.58592 WP_000456486.1.58598 WP_000456486.1.58704 WP_000456486.1.58735 WP_000456486.1.58760 WP_000456486.1.58763 WP_000456486.1.58772 WP_000456486.1.5880 WP_000456486.1.58833 WP_000456486.1.58934 WP_000456486.1.58981 WP_000456486.1.59011 WP_000456486.1.59014 WP_000456486.1.59039 WP_000456486.1.59077 WP_000456486.1.59098 WP_000456486.1.59124 WP_000456486.1.59146 WP_000456486.1.5920 WP_000456486.1.59311 WP_000456486.1.59398 WP_000456486.1.5940 WP_000456486.1.59404 WP_000456486.1.59462 WP_000456486.1.59464 WP_000456486.1.59498 WP_000456486.1.59540 WP_000456486.1.59546 WP_000456486.1.59598 WP_000456486.1.59668 WP_000456486.1.59669 WP_000456486.1.59671 WP_000456486.1.5972 WP_000456486.1.59787 WP_000456486.1.5982 WP_000456486.1.59822 WP_000456486.1.59874 WP_000456486.1.59907 WP_000456486.1.59915 WP_000456486.1.60006 WP_000456486.1.6006 WP_000456486.1.6011 WP_000456486.1.60123 WP_000456486.1.60147 WP_000456486.1.60149 WP_000456486.1.60157 WP_000456486.1.6017 WP_000456486.1.60227 WP_000456486.1.60302 WP_000456486.1.60345 WP_000456486.1.60353 WP_000456486.1.60434 WP_000456486.1.60492 WP_000456486.1.60547 WP_000456486.1.60585 WP_000456486.1.60595 WP_000456486.1.60636 WP_000456486.1.60641 WP_000456486.1.60734 WP_000456486.1.60750 WP_000456486.1.60751 WP_000456486.1.60758 WP_000456486.1.60759 WP_000456486.1.60765 WP_000456486.1.60778 WP_000456486.1.60813 WP_000456486.1.60820 WP_000456486.1.60845 WP_000456486.1.6085 WP_000456486.1.60869 WP_000456486.1.60888 WP_000456486.1.60912 WP_000456486.1.60923 WP_000456486.1.60948 WP_000456486.1.60965 WP_000456486.1.60991 WP_000456486.1.61013 WP_000456486.1.61026 WP_000456486.1.61029 WP_000456486.1.61031 WP_000456486.1.61082 WP_000456486.1.61115 WP_000456486.1.61139 WP_000456486.1.61189 WP_000456486.1.6119 WP_000456486.1.6123 WP_000456486.1.61263 WP_000456486.1.61271 WP_000456486.1.61289 WP_000456486.1.61313 WP_000456486.1.61316 WP_000456486.1.6136 WP_000456486.1.61375 WP_000456486.1.61430 WP_000456486.1.61439 WP_000456486.1.61440 WP_000456486.1.61555 WP_000456486.1.61585 WP_000456486.1.61597 WP_000456486.1.61615 WP_000456486.1.61639 WP_000456486.1.6166 WP_000456486.1.61705 WP_000456486.1.61749 WP_000456486.1.61800 WP_000456486.1.61802 WP_000456486.1.61838 WP_000456486.1.61903 WP_000456486.1.61936 WP_000456486.1.61978 WP_000456486.1.62002 WP_000456486.1.6201 WP_000456486.1.62028 WP_000456486.1.62069 WP_000456486.1.62071 WP_000456486.1.62096 WP_000456486.1.62247 WP_000456486.1.62254 WP_000456486.1.62346 WP_000456486.1.62352 WP_000456486.1.62382 WP_000456486.1.62398 WP_000456486.1.62429 WP_000456486.1.62453 WP_000456486.1.62474 WP_000456486.1.62496 WP_000456486.1.6250 WP_000456486.1.62553 WP_000456486.1.62602 WP_000456486.1.62653 WP_000456486.1.62671 WP_000456486.1.62674 WP_000456486.1.6268 WP_000456486.1.62684 WP_000456486.1.62723 WP_000456486.1.62764 WP_000456486.1.62771 WP_000456486.1.62822 WP_000456486.1.62824 WP_000456486.1.62831 WP_000456486.1.62863 WP_000456486.1.62880 WP_000456486.1.62970 WP_000456486.1.63003 WP_000456486.1.63027 WP_000456486.1.63052 WP_000456486.1.63070 WP_000456486.1.63083 WP_000456486.1.63139 WP_000456486.1.63140 WP_000456486.1.63220 WP_000456486.1.63266 WP_000456486.1.63289 WP_000456486.1.63304 WP_000456486.1.63313 WP_000456486.1.63333 WP_000456486.1.63341 WP_000456486.1.63441 WP_000456486.1.63469 WP_000456486.1.63471 WP_000456486.1.63589 WP_000456486.1.63673 WP_000456486.1.63726 WP_000456486.1.63729 WP_000456486.1.63751 WP_000456486.1.63759 WP_000456486.1.63774 WP_000456486.1.63828 WP_000456486.1.6388 WP_000456486.1.63907 WP_000456486.1.6403 WP_000456486.1.6408 WP_000456486.1.64192 WP_000456486.1.64250 WP_000456486.1.64367 WP_000456486.1.6438 WP_000456486.1.64456 WP_000456486.1.64457 WP_000456486.1.64525 WP_000456486.1.64565 WP_000456486.1.64583 WP_000456486.1.6459 WP_000456486.1.6462 WP_000456486.1.64631 WP_000456486.1.64677 WP_000456486.1.64686 WP_000456486.1.64720 WP_000456486.1.64765 WP_000456486.1.6479 WP_000456486.1.64858 WP_000456486.1.64879 WP_000456486.1.6488 WP_000456486.1.64893 WP_000456486.1.64897 WP_000456486.1.64928 WP_000456486.1.64935 WP_000456486.1.64961 WP_000456486.1.65044 WP_000456486.1.65132 WP_000456486.1.65158 WP_000456486.1.65180 WP_000456486.1.65193 WP_000456486.1.65217 WP_000456486.1.65243 WP_000456486.1.65317 WP_000456486.1.65367 WP_000456486.1.65419 WP_000456486.1.65423 WP_000456486.1.65432 WP_000456486.1.65443 WP_000456486.1.65451 WP_000456486.1.6547 WP_000456486.1.65504 WP_000456486.1.6551 WP_000456486.1.65520 WP_000456486.1.65544 WP_000456486.1.65562 WP_000456486.1.65675 WP_000456486.1.65689 WP_000456486.1.65693 WP_000456486.1.65700 WP_000456486.1.65703 WP_000456486.1.65705 WP_000456486.1.65856 WP_000456486.1.65922 WP_000456486.1.65931 WP_000456486.1.66009 WP_000456486.1.66081 WP_000456486.1.661 WP_000456486.1.66120 WP_000456486.1.66133 WP_000456486.1.66175 WP_000456486.1.66262 WP_000456486.1.66302 WP_000456486.1.66433 WP_000456486.1.66505 WP_000456486.1.66519 WP_000456486.1.66542 WP_000456486.1.66564 WP_000456486.1.66588 WP_000456486.1.66601 WP_000456486.1.66606 WP_000456486.1.66664 WP_000456486.1.66677 WP_000456486.1.66711 WP_000456486.1.6674 WP_000456486.1.66786 WP_000456486.1.66818 WP_000456486.1.6684 WP_000456486.1.67112 WP_000456486.1.67135 WP_000456486.1.67191 WP_000456486.1.6722 WP_000456486.1.67266 WP_000456486.1.67329 WP_000456486.1.67333 WP_000456486.1.6740 WP_000456486.1.67414 WP_000456486.1.67463 WP_000456486.1.67480 WP_000456486.1.67505 WP_000456486.1.67507 WP_000456486.1.67520 WP_000456486.1.67521 WP_000456486.1.67554 WP_000456486.1.67572 WP_000456486.1.67632 WP_000456486.1.67651 WP_000456486.1.67652 WP_000456486.1.67713 WP_000456486.1.67722 WP_000456486.1.67754 WP_000456486.1.67815 WP_000456486.1.6786 WP_000456486.1.67865 WP_000456486.1.67925 WP_000456486.1.67986 WP_000456486.1.68033 WP_000456486.1.68054 WP_000456486.1.68066 WP_000456486.1.6811 WP_000456486.1.68111 WP_000456486.1.68160 WP_000456486.1.68161 WP_000456486.1.68199 WP_000456486.1.68261 WP_000456486.1.68295 WP_000456486.1.6830 WP_000456486.1.68307 WP_000456486.1.6834 WP_000456486.1.68343 WP_000456486.1.68351 WP_000456486.1.68367 WP_000456486.1.6839 WP_000456486.1.68397 WP_000456486.1.68404 WP_000456486.1.68425 WP_000456486.1.68483 WP_000456486.1.68489 WP_000456486.1.68522 WP_000456486.1.68565 WP_000456486.1.68650 WP_000456486.1.68699 WP_000456486.1.68703 WP_000456486.1.68728 WP_000456486.1.68737 WP_000456486.1.68775 WP_000456486.1.68813 WP_000456486.1.68831 WP_000456486.1.68854 WP_000456486.1.68875 WP_000456486.1.68943 WP_000456486.1.68944 WP_000456486.1.69045 WP_000456486.1.69087 WP_000456486.1.69089 WP_000456486.1.6917 WP_000456486.1.69191 WP_000456486.1.69219 WP_000456486.1.69222 WP_000456486.1.69237 WP_000456486.1.69366 WP_000456486.1.69395 WP_000456486.1.69415 WP_000456486.1.69476 WP_000456486.1.69552 WP_000456486.1.69563 WP_000456486.1.69622 WP_000456486.1.69679 WP_000456486.1.69878 WP_000456486.1.69921 WP_000456486.1.69987 WP_000456486.1.70024 WP_000456486.1.70048 WP_000456486.1.70105 WP_000456486.1.7012 WP_000456486.1.70133 WP_000456486.1.7024 WP_000456486.1.70253 WP_000456486.1.70273 WP_000456486.1.703 WP_000456486.1.7034 WP_000456486.1.70344 WP_000456486.1.70349 WP_000456486.1.7043 WP_000456486.1.70451 WP_000456486.1.70459 WP_000456486.1.70462 WP_000456486.1.7053 WP_000456486.1.70546 WP_000456486.1.7061 WP_000456486.1.70635 WP_000456486.1.70641 WP_000456486.1.7067 WP_000456486.1.7073 WP_000456486.1.70818 WP_000456486.1.70823 WP_000456486.1.70855 WP_000456486.1.70924 WP_000456486.1.70930 WP_000456486.1.70943 WP_000456486.1.71043 WP_000456486.1.71058 WP_000456486.1.71059 WP_000456486.1.71073 WP_000456486.1.7109 WP_000456486.1.71130 WP_000456486.1.71196 WP_000456486.1.7120 WP_000456486.1.7125 WP_000456486.1.71295 WP_000456486.1.71298 WP_000456486.1.71325 WP_000456486.1.71345 WP_000456486.1.71359 WP_000456486.1.71463 WP_000456486.1.7150 WP_000456486.1.71519 WP_000456486.1.71529 WP_000456486.1.71543 WP_000456486.1.71596 WP_000456486.1.71602 WP_000456486.1.7161 WP_000456486.1.71662 WP_000456486.1.71676 WP_000456486.1.71735 WP_000456486.1.71780 WP_000456486.1.7179 WP_000456486.1.71861 WP_000456486.1.71925 WP_000456486.1.71989 WP_000456486.1.72026 WP_000456486.1.72031 WP_000456486.1.72067 WP_000456486.1.72169 WP_000456486.1.72205 WP_000456486.1.72271 WP_000456486.1.72330 WP_000456486.1.72347 WP_000456486.1.7236 WP_000456486.1.72366 WP_000456486.1.72424 WP_000456486.1.72547 WP_000456486.1.72654 WP_000456486.1.72787 WP_000456486.1.72832 WP_000456486.1.72835 WP_000456486.1.72903 WP_000456486.1.72904 WP_000456486.1.72935 WP_000456486.1.72945 WP_000456486.1.73017 WP_000456486.1.73019 WP_000456486.1.73022 WP_000456486.1.73037 WP_000456486.1.73122 WP_000456486.1.73132 WP_000456486.1.73246 WP_000456486.1.73265 WP_000456486.1.73286 WP_000456486.1.73386 WP_000456486.1.73456 WP_000456486.1.73501 WP_000456486.1.73571 WP_000456486.1.73591 WP_000456486.1.736 WP_000456486.1.73639 WP_000456486.1.73685 WP_000456486.1.73735 WP_000456486.1.73759 WP_000456486.1.73786 WP_000456486.1.73834 WP_000456486.1.73858 WP_000456486.1.73910 WP_000456486.1.73920 WP_000456486.1.73961 WP_000456486.1.73969 WP_000456486.1.73976 WP_000456486.1.73983 WP_000456486.1.74006 WP_000456486.1.74010 WP_000456486.1.74027 WP_000456486.1.74081 WP_000456486.1.74157 WP_000456486.1.74161 WP_000456486.1.74173 WP_000456486.1.74183 WP_000456486.1.74216 WP_000456486.1.74234 WP_000456486.1.7427 WP_000456486.1.7434 WP_000456486.1.74353 WP_000456486.1.74356 WP_000456486.1.74380 WP_000456486.1.74429 WP_000456486.1.74457 WP_000456486.1.7457 WP_000456486.1.74587 WP_000456486.1.74610 WP_000456486.1.74638 WP_000456486.1.74696 WP_000456486.1.74704 WP_000456486.1.74731 WP_000456486.1.74747 WP_000456486.1.74802 WP_000456486.1.74866 WP_000456486.1.74890 WP_000456486.1.74911 WP_000456486.1.74922 WP_000456486.1.74961 WP_000456486.1.74994 WP_000456486.1.74999 WP_000456486.1.75038 WP_000456486.1.75052 WP_000456486.1.75186 WP_000456486.1.75227 WP_000456486.1.75252 WP_000456486.1.75253 WP_000456486.1.75294 WP_000456486.1.75298 WP_000456486.1.75320 WP_000456486.1.75327 WP_000456486.1.75349 WP_000456486.1.75365 WP_000456486.1.75399 WP_000456486.1.7542 WP_000456486.1.75438 WP_000456486.1.75440 WP_000456486.1.75527 WP_000456486.1.75551 WP_000456486.1.7561 WP_000456486.1.75649 WP_000456486.1.75652 WP_000456486.1.75685 WP_000456486.1.75769 WP_000456486.1.75775 WP_000456486.1.758 WP_000456486.1.75830 WP_000456486.1.75881 WP_000456486.1.75885 WP_000456486.1.75929 WP_000456486.1.75952 WP_000456486.1.7596 WP_000456486.1.75969 WP_000456486.1.76010 WP_000456486.1.76015 WP_000456486.1.76095 WP_000456486.1.76143 WP_000456486.1.76230 WP_000456486.1.76234 WP_000456486.1.7624 WP_000456486.1.7625 WP_000456486.1.76258 WP_000456486.1.76261 WP_000456486.1.76332 WP_000456486.1.76337 WP_000456486.1.76351 WP_000456486.1.76419 WP_000456486.1.76420 WP_000456486.1.76421 WP_000456486.1.76606 WP_000456486.1.76624 WP_000456486.1.76648 WP_000456486.1.76686 WP_000456486.1.76690 WP_000456486.1.76693 WP_000456486.1.7675 WP_000456486.1.76790 WP_000456486.1.76792 WP_000456486.1.768 WP_000456486.1.76816 WP_000456486.1.76839 WP_000456486.1.76845 WP_000456486.1.76897 WP_000456486.1.76921 WP_000456486.1.76944 WP_000456486.1.76952 WP_000456486.1.76998 WP_000456486.1.77031 WP_000456486.1.77041 WP_000456486.1.77050 WP_000456486.1.77060 WP_000456486.1.77062 WP_000456486.1.77112 WP_000456486.1.77145 WP_000456486.1.77305 WP_000456486.1.7745 WP_000456486.1.7746 WP_000456486.1.77489 WP_000456486.1.77497 WP_000456486.1.77520 WP_000456486.1.77527 WP_000456486.1.77533 WP_000456486.1.77536 WP_000456486.1.77572 WP_000456486.1.77603 WP_000456486.1.77606 WP_000456486.1.77738 WP_000456486.1.7774 WP_000456486.1.77743 WP_000456486.1.77818 WP_000456486.1.77822 WP_000456486.1.77848 WP_000456486.1.77858 WP_000456486.1.7787 WP_000456486.1.77957 WP_000456486.1.78054 WP_000456486.1.78173 WP_000456486.1.78189 WP_000456486.1.78207 WP_000456486.1.78252 WP_000456486.1.78254 WP_000456486.1.7827 WP_000456486.1.78311 WP_000456486.1.78332 WP_000456486.1.78365 WP_000456486.1.78404 WP_000456486.1.7850 WP_000456486.1.78558 WP_000456486.1.7857 WP_000456486.1.78604 WP_000456486.1.78653 WP_000456486.1.78667 WP_000456486.1.78728 WP_000456486.1.78803 WP_000456486.1.78841 WP_000456486.1.78897 WP_000456486.1.78946 WP_000456486.1.78983 WP_000456486.1.7900 WP_000456486.1.79006 WP_000456486.1.79038 WP_000456486.1.79051 WP_000456486.1.79085 WP_000456486.1.79131 WP_000456486.1.79170 WP_000456486.1.79197 WP_000456486.1.79208 WP_000456486.1.79223 WP_000456486.1.7931 WP_000456486.1.79310 WP_000456486.1.79314 WP_000456486.1.79322 WP_000456486.1.79332 WP_000456486.1.79367 WP_000456486.1.79374 WP_000456486.1.79436 WP_000456486.1.79461 WP_000456486.1.79476 WP_000456486.1.79487 WP_000456486.1.79539 WP_000456486.1.79556 WP_000456486.1.79626 WP_000456486.1.79662 WP_000456486.1.79672 WP_000456486.1.79706 WP_000456486.1.79822 WP_000456486.1.79831 WP_000456486.1.79834 WP_000456486.1.79837 WP_000456486.1.7989 WP_000456486.1.79896 WP_000456486.1.79911 WP_000456486.1.7992 WP_000456486.1.79941 WP_000456486.1.79961 WP_000456486.1.79971 WP_000456486.1.79991 WP_000456486.1.80000 WP_000456486.1.80032 WP_000456486.1.80042 WP_000456486.1.80079 WP_000456486.1.80109 WP_000456486.1.80127 WP_000456486.1.80203 WP_000456486.1.80287 WP_000456486.1.80290 WP_000456486.1.8031 WP_000456486.1.8035 WP_000456486.1.80358 WP_000456486.1.80378 WP_000456486.1.8043 WP_000456486.1.80472 WP_000456486.1.80530 WP_000456486.1.8065 WP_000456486.1.80687 WP_000456486.1.80717 WP_000456486.1.80761 WP_000456486.1.80763 WP_000456486.1.80781 WP_000456486.1.80786 WP_000456486.1.80833 WP_000456486.1.8084 WP_000456486.1.80872 WP_000456486.1.80962 WP_000456486.1.81085 WP_000456486.1.81114 WP_000456486.1.81157 WP_000456486.1.81171 WP_000456486.1.81234 WP_000456486.1.8125 WP_000456486.1.81252 WP_000456486.1.81344 WP_000456486.1.8135 WP_000456486.1.81385 WP_000456486.1.81389 WP_000456486.1.8142 WP_000456486.1.8144 WP_000456486.1.81464 WP_000456486.1.81467 WP_000456486.1.81599 WP_000456486.1.81610 WP_000456486.1.81740 WP_000456486.1.81758 WP_000456486.1.81800 WP_000456486.1.81810 WP_000456486.1.81812 WP_000456486.1.81831 WP_000456486.1.81861 WP_000456486.1.81870 WP_000456486.1.81897 WP_000456486.1.81903 WP_000456486.1.81905 WP_000456486.1.81906 WP_000456486.1.81919 WP_000456486.1.81944 WP_000456486.1.81955 WP_000456486.1.81999 WP_000456486.1.82009 WP_000456486.1.82053 WP_000456486.1.8212 WP_000456486.1.82121 WP_000456486.1.82219 WP_000456486.1.82247 WP_000456486.1.82259 WP_000456486.1.82340 WP_000456486.1.82354 WP_000456486.1.82358 WP_000456486.1.82368 WP_000456486.1.82447 WP_000456486.1.8246 WP_000456486.1.82467 WP_000456486.1.82548 WP_000456486.1.82612 WP_000456486.1.8265 WP_000456486.1.82709 WP_000456486.1.82724 WP_000456486.1.82796 WP_000456486.1.8280 WP_000456486.1.82802 WP_000456486.1.82829 WP_000456486.1.82862 WP_000456486.1.8289 WP_000456486.1.82976 WP_000456486.1.82980 WP_000456486.1.83152 WP_000456486.1.83153 WP_000456486.1.83185 WP_000456486.1.83193 WP_000456486.1.83234 WP_000456486.1.83316 WP_000456486.1.83352 WP_000456486.1.83372 WP_000456486.1.83418 WP_000456486.1.83476 WP_000456486.1.83484 WP_000456486.1.83517 WP_000456486.1.83593 WP_000456486.1.83646 WP_000456486.1.83653 WP_000456486.1.83676 WP_000456486.1.83720 WP_000456486.1.83763 WP_000456486.1.83769 WP_000456486.1.83775 WP_000456486.1.83804 WP_000456486.1.83825 WP_000456486.1.8383 WP_000456486.1.83864 WP_000456486.1.83865 WP_000456486.1.83881 WP_000456486.1.83912 WP_000456486.1.83919 WP_000456486.1.83928 WP_000456486.1.83955 WP_000456486.1.83984 WP_000456486.1.84049 WP_000456486.1.84064 WP_000456486.1.84144 WP_000456486.1.84163 WP_000456486.1.84293 WP_000456486.1.84342 WP_000456486.1.84442 WP_000456486.1.84445 WP_000456486.1.84451 WP_000456486.1.84509 WP_000456486.1.84563 WP_000456486.1.84578 WP_000456486.1.84625 WP_000456486.1.84638 WP_000456486.1.8468 WP_000456486.1.84682 WP_000456486.1.8475 WP_000456486.1.84752 WP_000456486.1.84757 WP_000456486.1.84761 WP_000456486.1.84815 WP_000456486.1.84889 WP_000456486.1.84903 WP_000456486.1.84907 WP_000456486.1.84922 WP_000456486.1.8493 WP_000456486.1.85022 WP_000456486.1.85047 WP_000456486.1.85056 WP_000456486.1.85081 WP_000456486.1.85099 WP_000456486.1.85135 WP_000456486.1.85144 WP_000456486.1.85151 WP_000456486.1.85213 WP_000456486.1.85226 WP_000456486.1.85235 WP_000456486.1.85238 WP_000456486.1.85351 WP_000456486.1.85383 WP_000456486.1.85395 WP_000456486.1.85404 WP_000456486.1.85445 WP_000456486.1.85462 WP_000456486.1.85471 WP_000456486.1.85474 WP_000456486.1.85492 WP_000456486.1.85506 WP_000456486.1.85515 WP_000456486.1.85519 WP_000456486.1.85547 WP_000456486.1.85586 WP_000456486.1.85649 WP_000456486.1.85758 WP_000456486.1.85795 WP_000456486.1.85796 WP_000456486.1.85816 WP_000456486.1.85834 WP_000456486.1.85927 WP_000456486.1.85950 WP_000456486.1.85993 WP_000456486.1.86018 WP_000456486.1.86072 WP_000456486.1.86123 WP_000456486.1.86144 WP_000456486.1.86154 WP_000456486.1.86158 WP_000456486.1.86188 WP_000456486.1.86207 WP_000456486.1.86248 WP_000456486.1.8627 WP_000456486.1.86270 WP_000456486.1.86344 WP_000456486.1.86367 WP_000456486.1.86378 WP_000456486.1.8643 WP_000456486.1.86439 WP_000456486.1.86482 WP_000456486.1.86523 WP_000456486.1.86542 WP_000456486.1.86628 WP_000456486.1.86706 WP_000456486.1.86792 WP_000456486.1.8681 WP_000456486.1.86838 WP_000456486.1.86911 WP_000456486.1.86940 WP_000456486.1.86961 WP_000456486.1.86977 WP_000456486.1.87021 WP_000456486.1.87042 WP_000456486.1.87057 WP_000456486.1.87072 WP_000456486.1.87090 WP_000456486.1.87119 WP_000456486.1.87122 WP_000456486.1.87141 WP_000456486.1.87175 WP_000456486.1.87194 WP_000456486.1.8720 WP_000456486.1.87260 WP_000456486.1.87261 WP_000456486.1.87285 WP_000456486.1.87290 WP_000456486.1.8731 WP_000456486.1.87396 WP_000456486.1.87457 WP_000456486.1.87461 WP_000456486.1.87466 WP_000456486.1.875 WP_000456486.1.87508 WP_000456486.1.87515 WP_000456486.1.8753 WP_000456486.1.87543 WP_000456486.1.87710 WP_000456486.1.87718 WP_000456486.1.87748 WP_000456486.1.87764 WP_000456486.1.8779 WP_000456486.1.87808 WP_000456486.1.87828 WP_000456486.1.87879 WP_000456486.1.87912 WP_000456486.1.87963 WP_000456486.1.87972 WP_000456486.1.87995 WP_000456486.1.88013 WP_000456486.1.88032 WP_000456486.1.88061 WP_000456486.1.88114 WP_000456486.1.88150 WP_000456486.1.88270 WP_000456486.1.88317 WP_000456486.1.88319 WP_000456486.1.88351 WP_000456486.1.88367 WP_000456486.1.88371 WP_000456486.1.88380 WP_000456486.1.88480 WP_000456486.1.88498 WP_000456486.1.88518 WP_000456486.1.88558 WP_000456486.1.8857 WP_000456486.1.88580 WP_000456486.1.88599 WP_000456486.1.88623 WP_000456486.1.88636 WP_000456486.1.88642 WP_000456486.1.88671 WP_000456486.1.88694 WP_000456486.1.8872 WP_000456486.1.88739 WP_000456486.1.88856 WP_000456486.1.88859 WP_000456486.1.8888 WP_000456486.1.88922 WP_000456486.1.88934 WP_000456486.1.8900 WP_000456486.1.89086 WP_000456486.1.8913 WP_000456486.1.89133 WP_000456486.1.89181 WP_000456486.1.89194 WP_000456486.1.89195 WP_000456486.1.89204 WP_000456486.1.8924 WP_000456486.1.89258 WP_000456486.1.89284 WP_000456486.1.89516 WP_000456486.1.89537 WP_000456486.1.89544 WP_000456486.1.89545 WP_000456486.1.89559 WP_000456486.1.89655 WP_000456486.1.89672 WP_000456486.1.89678 WP_000456486.1.89726 WP_000456486.1.89730 WP_000456486.1.89754 WP_000456486.1.89883 WP_000456486.1.89935 WP_000456486.1.89960 WP_000456486.1.90005 WP_000456486.1.90018 WP_000456486.1.90038 WP_000456486.1.90046 WP_000456486.1.90055 WP_000456486.1.90091 WP_000456486.1.90131 WP_000456486.1.90148 WP_000456486.1.90161 WP_000456486.1.90180 WP_000456486.1.90215 WP_000456486.1.9022 WP_000456486.1.90243 WP_000456486.1.90253 WP_000456486.1.90276 WP_000456486.1.9030 WP_000456486.1.90331 WP_000456486.1.90367 WP_000456486.1.90473 WP_000456486.1.90544 WP_000456486.1.90554 WP_000456486.1.90604 WP_000456486.1.90647 WP_000456486.1.90660 WP_000456486.1.90683 WP_000456486.1.90726 WP_000456486.1.90728 WP_000456486.1.90738 WP_000456486.1.90745 WP_000456486.1.90801 WP_000456486.1.90804 WP_000456486.1.90861 WP_000456486.1.90896 WP_000456486.1.90903 WP_000456486.1.9100 WP_000456486.1.91011 WP_000456486.1.91054 WP_000456486.1.91126 WP_000456486.1.9114 WP_000456486.1.91158 WP_000456486.1.912 WP_000456486.1.91233 WP_000456486.1.91246 WP_000456486.1.91258 WP_000456486.1.91279 WP_000456486.1.91300 WP_000456486.1.91332 WP_000456486.1.91346 WP_000456486.1.91357 WP_000456486.1.91364 WP_000456486.1.91382 WP_000456486.1.9140 WP_000456486.1.91420 WP_000456486.1.91427 WP_000456486.1.91487 WP_000456486.1.91500 WP_000456486.1.91559 WP_000456486.1.91573 WP_000456486.1.91581 WP_000456486.1.91587 WP_000456486.1.91639 WP_000456486.1.91749 WP_000456486.1.91771 WP_000456486.1.91791 WP_000456486.1.91800 WP_000456486.1.91816 WP_000456486.1.91829 WP_000456486.1.91895 WP_000456486.1.91928 WP_000456486.1.91950 WP_000456486.1.92 WP_000456486.1.92133 WP_000456486.1.92140 WP_000456486.1.92164 WP_000456486.1.92169 WP_000456486.1.92173 WP_000456486.1.92185 WP_000456486.1.92196 WP_000456486.1.92227 WP_000456486.1.9224 WP_000456486.1.92253 WP_000456486.1.9234 WP_000456486.1.9239 WP_000456486.1.92436 WP_000456486.1.92442 WP_000456486.1.92497 WP_000456486.1.92500 WP_000456486.1.92520 WP_000456486.1.92534 WP_000456486.1.92565 WP_000456486.1.92607 WP_000456486.1.92679 WP_000456486.1.92691 WP_000456486.1.92723 WP_000456486.1.92735 WP_000456486.1.92741 WP_000456486.1.92773 WP_000456486.1.92789 WP_000456486.1.92805 WP_000456486.1.92862 WP_000456486.1.92864 WP_000456486.1.9293 WP_000456486.1.92950 WP_000456486.1.93074 WP_000456486.1.93125 WP_000456486.1.93163 WP_000456486.1.93176 WP_000456486.1.93191 WP_000456486.1.93224 WP_000456486.1.93300 WP_000456486.1.93336 WP_000456486.1.93416 WP_000456486.1.93438 WP_000456486.1.93444 WP_000456486.1.93514 WP_000456486.1.9352 WP_000456486.1.9354 WP_000456486.1.9358 WP_000456486.1.93590 WP_000456486.1.93658 WP_000456486.1.93678 WP_000456486.1.93710 WP_000456486.1.93722 WP_000456486.1.93738 WP_000456486.1.93769 WP_000456486.1.93787 WP_000456486.1.9387 WP_000456486.1.93882 WP_000456486.1.93883 WP_000456486.1.93891 WP_000456486.1.93976 WP_000456486.1.9398 WP_000456486.1.93981 WP_000456486.1.94074 WP_000456486.1.94082 WP_000456486.1.94087 WP_000456486.1.94096 WP_000456486.1.94119 WP_000456486.1.94165 WP_000456486.1.94172 WP_000456486.1.94293 WP_000456486.1.94294 WP_000456486.1.94335 WP_000456486.1.94340 WP_000456486.1.9437 WP_000456486.1.94374 WP_000456486.1.94375 WP_000456486.1.94376 WP_000456486.1.94389 WP_000456486.1.94414 WP_000456486.1.94530 WP_000456486.1.94550 WP_000456486.1.94576 WP_000456486.1.9464 WP_000456486.1.94688 WP_000456486.1.94733 WP_000456486.1.94741 WP_000456486.1.94789 WP_000456486.1.94844 WP_000456486.1.94845 WP_000456486.1.9485 WP_000456486.1.94857 WP_000456486.1.94866 WP_000456486.1.9497 WP_000456486.1.94980 WP_000456486.1.94989 WP_000456486.1.94999 WP_000456486.1.95038 WP_000456486.1.95077 WP_000456486.1.9510 WP_000456486.1.95120 WP_000456486.1.95327 WP_000456486.1.95342 WP_000456486.1.95361 WP_000456486.1.95372 WP_000456486.1.9538 WP_000456486.1.95537 WP_000456486.1.95581 WP_000456486.1.95603 WP_000456486.1.95639 WP_000456486.1.95681 WP_000456486.1.95699 WP_000456486.1.95704 WP_000456486.1.95713 WP_000456486.1.95714 WP_000456486.1.95737 WP_000456486.1.95760 WP_000456486.1.95806 WP_000456486.1.95877 WP_000456486.1.95885 WP_000456486.1.95914 WP_000456486.1.95918 WP_000456486.1.95986 WP_000456486.1.95997 WP_000456486.1.96014 WP_000456486.1.96030 WP_000456486.1.96056 WP_000456486.1.96057 WP_000456486.1.96067 WP_000456486.1.96075 WP_000456486.1.96135 WP_000456486.1.96148 WP_000456486.1.96228 WP_000456486.1.96255 WP_000456486.1.96283 WP_000456486.1.96297 WP_000456486.1.96312 WP_000456486.1.96314 WP_000456486.1.96322 WP_000456486.1.96334 WP_000456486.1.96362 WP_000456486.1.96433 WP_000456486.1.96472 WP_000456486.1.9650 WP_000456486.1.96535 WP_000456486.1.96538 WP_000456486.1.96554 WP_000456486.1.96566 WP_000456486.1.96591 WP_000456486.1.96603 WP_000456486.1.96678 WP_000456486.1.96699 WP_000456486.1.96705 WP_000456486.1.9675 WP_000456486.1.96780 WP_000456486.1.96836 WP_000456486.1.96855 WP_000456486.1.96859 WP_000456486.1.96922 WP_000456486.1.96965 WP_000456486.1.96969 WP_000456486.1.96985 WP_000456486.1.96997 WP_000456486.1.97000 WP_000456486.1.97014 WP_000456486.1.97029 WP_000456486.1.97034 WP_000456486.1.97141 WP_000456486.1.97161 WP_000456486.1.97164 WP_000456486.1.97205 WP_000456486.1.97228 WP_000456486.1.97230 WP_000456486.1.97241 WP_000456486.1.97312 WP_000456486.1.97336 WP_000456486.1.97348 WP_000456486.1.97352 WP_000456486.1.97355 WP_000456486.1.97367 WP_000456486.1.9737 WP_000456486.1.97392 WP_000456486.1.97427 WP_000456486.1.97450 WP_000456486.1.97456 WP_000456486.1.97494 WP_000456486.1.97530 WP_000456486.1.97531 WP_000456486.1.97537 WP_000456486.1.97576 WP_000456486.1.97585 WP_000456486.1.97664 WP_000456486.1.97687 WP_000456486.1.97696 WP_000456486.1.97699 WP_000456486.1.97744 WP_000456486.1.97746 WP_000456486.1.97762 WP_000456486.1.9788 WP_000456486.1.97935 WP_000456486.1.97955 WP_000456486.1.97974 WP_000456486.1.97997 WP_000456486.1.98058 WP_000456486.1.98073 WP_000456486.1.98161 WP_000456486.1.98174 WP_000456486.1.98179 WP_000456486.1.98195 WP_000456486.1.98233 WP_000456486.1.98248 WP_000456486.1.98249 WP_000456486.1.98281 WP_000456486.1.98295 WP_000456486.1.98328 WP_000456486.1.98352 WP_000456486.1.98353 WP_000456486.1.98366 WP_000456486.1.98387 WP_000456486.1.98409 WP_000456486.1.98425 WP_000456486.1.98585 WP_000456486.1.98609 WP_000456486.1.98659 WP_000456486.1.98667 WP_000456486.1.9872 WP_000456486.1.98723 WP_000456486.1.98730 WP_000456486.1.98734 WP_000456486.1.98741 WP_000456486.1.98750 WP_000456486.1.98786 WP_000456486.1.98797 WP_000456486.1.98821 WP_000456486.1.98842 WP_000456486.1.98880 WP_000456486.1.98883 WP_000456486.1.98894 WP_000456486.1.98985 WP_000456486.1.9910 WP_000456486.1.99136 WP_000456486.1.99207 WP_000456486.1.99283 WP_000456486.1.99308 WP_000456486.1.99414 WP_000456486.1.99418 WP_000456486.1.99509 WP_000456486.1.99523 WP_000456486.1.9965 WP_000456486.1.99830 WP_000456486.1.99849 WP_000456486.1.99859 WP_000456486.1.99884 WP_000456486.1.99954 WP_000456486.1.99955 WP_000456486.1.99984 WP_000456486.1.99999 gi|387151557|ref|YP_005743121.1| gi|15928013|ref|NP_375546.1| gi|150394946|ref|YP_001317621.1| gi|15925425|ref|NP_372959.1| gi|384865613|ref|YP_005750972.1| 158878.SAV2435 158879.SA2223 359786.SaurJH9_2461 359787.SaurJH1_2510 418127.SAHV_2419 681288.SAAV_2501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]