SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157418272|ref|YP_001481344.1| from Escherichia coli APEC O1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157418272|ref|YP_001481344.1|
Domain Number 1 Region: 136-289
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000848
Family N-acetyl transferase, NAT 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157418272|ref|YP_001481344.1|
Sequence length 302
Comment hypothetical protein APECO1_O1CoBM188 [Escherichia coli APEC O1]
Sequence
MTLSIKNIKRIITAWKPSTFETYKKTFEKYGGSVNMHPDVVSYFMIHHDWKFDFFHYEKD
GDIKGSYFLCNGKQIGIMARRSYPLSSDEVLIPFSPHARCFFPDKTNKLSIINKQNIINA
TWKIARKKQNCIIKESFSPKFEKTRRNEIQRFIRNGGEIKCISQLSDKEISSSYISLFHS
RFGGTLPCYEYDNLLMFISHLRELMFGHVLFWDNKPCAIDIVLKSESSCNVYYDVPNGAV
LNDENCMKLSPGSVLMWLNIDKARRYCQDNNKKMIYSIGAFRPEWKYKLLWSVPCKVGKC
LC
Download sequence
Identical sequences A0A0H2XLD1 A0A0H3EQF6 A0A237C6A7 A0A2A2XJY4 B1LRS6 B7JCA1 B9K6H9 D7XPJ2 E1JBJ3 E1QMS2 E6BSV0 M1GEZ3 V0VTY2
gi|170650860|ref|YP_001739983.1| gi|157418272|ref|YP_001481344.1| gi|387615327|ref|YP_006162325.1| WP_000175738.1.100066 WP_000175738.1.100227 WP_000175738.1.100689 WP_000175738.1.100738 WP_000175738.1.10074 WP_000175738.1.100824 WP_000175738.1.101148 WP_000175738.1.101519 WP_000175738.1.10187 WP_000175738.1.101900 WP_000175738.1.101948 WP_000175738.1.10252 WP_000175738.1.10989 WP_000175738.1.11068 WP_000175738.1.11467 WP_000175738.1.11531 WP_000175738.1.12157 WP_000175738.1.12717 WP_000175738.1.12761 WP_000175738.1.12831 WP_000175738.1.12876 WP_000175738.1.13015 WP_000175738.1.13031 WP_000175738.1.13252 WP_000175738.1.13278 WP_000175738.1.13924 WP_000175738.1.14346 WP_000175738.1.14538 WP_000175738.1.14601 WP_000175738.1.1470 WP_000175738.1.15304 WP_000175738.1.15377 WP_000175738.1.1543 WP_000175738.1.1561 WP_000175738.1.15645 WP_000175738.1.15945 WP_000175738.1.16000 WP_000175738.1.16154 WP_000175738.1.16667 WP_000175738.1.16745 WP_000175738.1.17102 WP_000175738.1.17297 WP_000175738.1.1749 WP_000175738.1.17584 WP_000175738.1.17920 WP_000175738.1.1821 WP_000175738.1.18316 WP_000175738.1.18482 WP_000175738.1.1873 WP_000175738.1.18734 WP_000175738.1.18858 WP_000175738.1.18899 WP_000175738.1.1896 WP_000175738.1.19114 WP_000175738.1.19146 WP_000175738.1.19245 WP_000175738.1.19374 WP_000175738.1.19478 WP_000175738.1.19534 WP_000175738.1.1987 WP_000175738.1.20251 WP_000175738.1.2027 WP_000175738.1.20289 WP_000175738.1.20325 WP_000175738.1.20596 WP_000175738.1.20863 WP_000175738.1.20982 WP_000175738.1.21122 WP_000175738.1.21286 WP_000175738.1.21399 WP_000175738.1.21573 WP_000175738.1.2164 WP_000175738.1.21756 WP_000175738.1.22138 WP_000175738.1.22189 WP_000175738.1.22204 WP_000175738.1.22565 WP_000175738.1.22631 WP_000175738.1.23005 WP_000175738.1.23026 WP_000175738.1.23105 WP_000175738.1.23175 WP_000175738.1.23500 WP_000175738.1.237 WP_000175738.1.23720 WP_000175738.1.23804 WP_000175738.1.23945 WP_000175738.1.24929 WP_000175738.1.24946 WP_000175738.1.2502 WP_000175738.1.25064 WP_000175738.1.2558 WP_000175738.1.25712 WP_000175738.1.26130 WP_000175738.1.26479 WP_000175738.1.2665 WP_000175738.1.26683 WP_000175738.1.2712 WP_000175738.1.27141 WP_000175738.1.27175 WP_000175738.1.27313 WP_000175738.1.27535 WP_000175738.1.27580 WP_000175738.1.27611 WP_000175738.1.27693 WP_000175738.1.27741 WP_000175738.1.27758 WP_000175738.1.28051 WP_000175738.1.28128 WP_000175738.1.28461 WP_000175738.1.29429 WP_000175738.1.2945 WP_000175738.1.29820 WP_000175738.1.30078 WP_000175738.1.30170 WP_000175738.1.30399 WP_000175738.1.30896 WP_000175738.1.31011 WP_000175738.1.31149 WP_000175738.1.31295 WP_000175738.1.31407 WP_000175738.1.31429 WP_000175738.1.31431 WP_000175738.1.31433 WP_000175738.1.31823 WP_000175738.1.31835 WP_000175738.1.32170 WP_000175738.1.32709 WP_000175738.1.32718 WP_000175738.1.32930 WP_000175738.1.33004 WP_000175738.1.33018 WP_000175738.1.33026 WP_000175738.1.33217 WP_000175738.1.33325 WP_000175738.1.33693 WP_000175738.1.33854 WP_000175738.1.3398 WP_000175738.1.34130 WP_000175738.1.34605 WP_000175738.1.34781 WP_000175738.1.35003 WP_000175738.1.3515 WP_000175738.1.35198 WP_000175738.1.35448 WP_000175738.1.35789 WP_000175738.1.35963 WP_000175738.1.36132 WP_000175738.1.3624 WP_000175738.1.365 WP_000175738.1.36886 WP_000175738.1.37352 WP_000175738.1.37544 WP_000175738.1.37634 WP_000175738.1.37762 WP_000175738.1.37773 WP_000175738.1.37880 WP_000175738.1.37887 WP_000175738.1.38185 WP_000175738.1.38622 WP_000175738.1.38694 WP_000175738.1.38811 WP_000175738.1.38830 WP_000175738.1.38911 WP_000175738.1.39042 WP_000175738.1.39164 WP_000175738.1.39275 WP_000175738.1.39708 WP_000175738.1.39796 WP_000175738.1.40025 WP_000175738.1.40238 WP_000175738.1.40499 WP_000175738.1.40686 WP_000175738.1.40813 WP_000175738.1.4082 WP_000175738.1.4126 WP_000175738.1.41371 WP_000175738.1.41402 WP_000175738.1.41417 WP_000175738.1.41436 WP_000175738.1.41741 WP_000175738.1.41780 WP_000175738.1.41847 WP_000175738.1.41885 WP_000175738.1.41904 WP_000175738.1.41923 WP_000175738.1.42433 WP_000175738.1.42516 WP_000175738.1.42522 WP_000175738.1.42661 WP_000175738.1.42771 WP_000175738.1.42804 WP_000175738.1.42891 WP_000175738.1.42918 WP_000175738.1.42937 WP_000175738.1.43216 WP_000175738.1.43598 WP_000175738.1.44020 WP_000175738.1.44096 WP_000175738.1.44292 WP_000175738.1.44354 WP_000175738.1.44587 WP_000175738.1.44608 WP_000175738.1.44849 WP_000175738.1.44975 WP_000175738.1.44998 WP_000175738.1.45229 WP_000175738.1.45301 WP_000175738.1.4541 WP_000175738.1.45806 WP_000175738.1.46197 WP_000175738.1.46263 WP_000175738.1.46932 WP_000175738.1.46991 WP_000175738.1.47028 WP_000175738.1.47034 WP_000175738.1.47038 WP_000175738.1.47039 WP_000175738.1.47054 WP_000175738.1.47344 WP_000175738.1.47477 WP_000175738.1.47761 WP_000175738.1.47764 WP_000175738.1.48018 WP_000175738.1.4811 WP_000175738.1.4876 WP_000175738.1.48918 WP_000175738.1.48953 WP_000175738.1.49061 WP_000175738.1.49076 WP_000175738.1.49258 WP_000175738.1.49662 WP_000175738.1.49675 WP_000175738.1.50270 WP_000175738.1.50353 WP_000175738.1.50427 WP_000175738.1.50616 WP_000175738.1.50996 WP_000175738.1.5124 WP_000175738.1.51253 WP_000175738.1.51330 WP_000175738.1.51548 WP_000175738.1.51629 WP_000175738.1.51690 WP_000175738.1.51837 WP_000175738.1.51881 WP_000175738.1.52801 WP_000175738.1.52881 WP_000175738.1.52908 WP_000175738.1.53203 WP_000175738.1.53242 WP_000175738.1.53262 WP_000175738.1.53587 WP_000175738.1.53592 WP_000175738.1.53693 WP_000175738.1.54013 WP_000175738.1.54102 WP_000175738.1.54429 WP_000175738.1.54591 WP_000175738.1.54875 WP_000175738.1.55151 WP_000175738.1.55179 WP_000175738.1.55197 WP_000175738.1.55374 WP_000175738.1.55472 WP_000175738.1.55552 WP_000175738.1.56164 WP_000175738.1.56197 WP_000175738.1.56528 WP_000175738.1.57487 WP_000175738.1.57494 WP_000175738.1.57709 WP_000175738.1.57854 WP_000175738.1.57982 WP_000175738.1.58107 WP_000175738.1.58232 WP_000175738.1.58440 WP_000175738.1.5846 WP_000175738.1.58737 WP_000175738.1.59291 WP_000175738.1.59292 WP_000175738.1.59730 WP_000175738.1.59756 WP_000175738.1.59823 WP_000175738.1.60228 WP_000175738.1.60387 WP_000175738.1.60505 WP_000175738.1.60576 WP_000175738.1.60630 WP_000175738.1.6086 WP_000175738.1.61551 WP_000175738.1.61758 WP_000175738.1.61779 WP_000175738.1.61939 WP_000175738.1.62120 WP_000175738.1.62296 WP_000175738.1.62424 WP_000175738.1.62447 WP_000175738.1.62784 WP_000175738.1.62819 WP_000175738.1.6282 WP_000175738.1.62866 WP_000175738.1.63455 WP_000175738.1.63466 WP_000175738.1.6348 WP_000175738.1.64285 WP_000175738.1.64286 WP_000175738.1.65306 WP_000175738.1.65749 WP_000175738.1.66368 WP_000175738.1.66667 WP_000175738.1.66751 WP_000175738.1.66795 WP_000175738.1.66825 WP_000175738.1.67055 WP_000175738.1.67373 WP_000175738.1.67495 WP_000175738.1.67581 WP_000175738.1.67617 WP_000175738.1.67758 WP_000175738.1.68911 WP_000175738.1.69551 WP_000175738.1.69593 WP_000175738.1.69887 WP_000175738.1.70047 WP_000175738.1.70300 WP_000175738.1.70492 WP_000175738.1.7050 WP_000175738.1.70655 WP_000175738.1.71183 WP_000175738.1.71294 WP_000175738.1.71972 WP_000175738.1.72028 WP_000175738.1.72186 WP_000175738.1.7225 WP_000175738.1.72283 WP_000175738.1.72316 WP_000175738.1.72359 WP_000175738.1.72588 WP_000175738.1.72643 WP_000175738.1.72706 WP_000175738.1.72751 WP_000175738.1.73039 WP_000175738.1.73340 WP_000175738.1.73349 WP_000175738.1.7374 WP_000175738.1.74028 WP_000175738.1.74358 WP_000175738.1.74365 WP_000175738.1.74574 WP_000175738.1.74623 WP_000175738.1.74687 WP_000175738.1.74854 WP_000175738.1.74946 WP_000175738.1.75594 WP_000175738.1.75672 WP_000175738.1.75758 WP_000175738.1.75839 WP_000175738.1.75999 WP_000175738.1.76019 WP_000175738.1.76547 WP_000175738.1.76562 WP_000175738.1.76831 WP_000175738.1.76918 WP_000175738.1.76965 WP_000175738.1.77007 WP_000175738.1.77341 WP_000175738.1.7747 WP_000175738.1.77629 WP_000175738.1.77632 WP_000175738.1.78089 WP_000175738.1.78610 WP_000175738.1.78845 WP_000175738.1.79276 WP_000175738.1.79414 WP_000175738.1.79505 WP_000175738.1.79525 WP_000175738.1.79591 WP_000175738.1.79619 WP_000175738.1.79877 WP_000175738.1.79930 WP_000175738.1.79945 WP_000175738.1.80255 WP_000175738.1.80310 WP_000175738.1.80343 WP_000175738.1.80519 WP_000175738.1.8057 WP_000175738.1.80768 WP_000175738.1.80819 WP_000175738.1.80927 WP_000175738.1.81067 WP_000175738.1.81156 WP_000175738.1.81186 WP_000175738.1.81212 WP_000175738.1.81347 WP_000175738.1.81396 WP_000175738.1.81409 WP_000175738.1.81418 WP_000175738.1.81548 WP_000175738.1.81576 WP_000175738.1.81589 WP_000175738.1.81624 WP_000175738.1.82123 WP_000175738.1.82636 WP_000175738.1.82799 WP_000175738.1.82833 WP_000175738.1.8295 WP_000175738.1.82991 WP_000175738.1.83218 WP_000175738.1.83252 WP_000175738.1.83564 WP_000175738.1.83936 WP_000175738.1.84534 WP_000175738.1.85048 WP_000175738.1.85094 WP_000175738.1.85773 WP_000175738.1.86104 WP_000175738.1.86266 WP_000175738.1.86283 WP_000175738.1.86307 WP_000175738.1.86411 WP_000175738.1.86833 WP_000175738.1.86902 WP_000175738.1.87147 WP_000175738.1.87310 WP_000175738.1.87358 WP_000175738.1.8767 WP_000175738.1.87694 WP_000175738.1.87726 WP_000175738.1.87834 WP_000175738.1.88110 WP_000175738.1.88238 WP_000175738.1.88505 WP_000175738.1.88603 WP_000175738.1.88620 WP_000175738.1.88729 WP_000175738.1.88880 WP_000175738.1.89174 WP_000175738.1.89432 WP_000175738.1.89492 WP_000175738.1.89788 WP_000175738.1.9036 WP_000175738.1.90602 WP_000175738.1.90792 WP_000175738.1.9081 WP_000175738.1.9119 WP_000175738.1.91220 WP_000175738.1.91268 WP_000175738.1.91666 WP_000175738.1.91951 WP_000175738.1.9199 WP_000175738.1.92053 WP_000175738.1.92114 WP_000175738.1.92311 WP_000175738.1.92648 WP_000175738.1.92750 WP_000175738.1.93052 WP_000175738.1.93072 WP_000175738.1.93533 WP_000175738.1.93837 WP_000175738.1.93870 WP_000175738.1.93877 WP_000175738.1.93918 WP_000175738.1.94282 WP_000175738.1.94317 WP_000175738.1.94430 WP_000175738.1.94542 WP_000175738.1.94653 WP_000175738.1.94754 WP_000175738.1.94889 WP_000175738.1.95005 WP_000175738.1.95428 WP_000175738.1.9559 WP_000175738.1.95824 WP_000175738.1.96494 WP_000175738.1.96585 WP_000175738.1.96633 WP_000175738.1.96695 WP_000175738.1.96797 WP_000175738.1.97170 WP_000175738.1.97238 WP_000175738.1.97282 WP_000175738.1.97538 WP_000175738.1.97628 WP_000175738.1.97932 WP_000175738.1.97962 WP_000175738.1.98026 WP_000175738.1.9803 WP_000175738.1.9844 WP_000175738.1.98775 WP_000175738.1.99209 WP_000175738.1.99219 WP_000175738.1.99295 WP_000175738.1.99549 WP_000175738.1.99771 WP_000175738.1.99827 YP_006162325.1.29421 CP001122|CDS_95918-95010 gi|157418272|ref|YP_001481344.1|NC_009837 gi|170650860|ref|YP_001739983.1|NC_010488 gi|194446943|ref|YP_002038977.1|NC_011076 gi|221218506|ref|YP_002527464.1|NC_011964 gi|222104908|ref|YP_002539397.1|NC_011980 gi|310286470|ref|YP_003937731.1|NC_014615 gi|387615327|ref|YP_006162325.1|NC_017659 gi|410691844|ref|YP_006970960.1|NC_018954 gi|410691972|ref|YP_006971087.1|NC_018966 gi|451344705|ref|YP_007443390.1|NC_020271 405955.APECO1_O1CoBM188 439855.EcSMS35_A0097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]