SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397668611|ref|YP_006510148.1| from Legionella pneumophila subsp. pneumophila

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397668611|ref|YP_006510148.1|
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily YccV-like 8.76e-25
Family YccV-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397668611|ref|YP_006510148.1|
Sequence length 103
Comment putative DNA-binding protein hemimethylated [Legionella pneumophila subsp. pneumophila]
Sequence
MNKIAKYNIGDLVIHKRIRYRAIVIDVDPIFQASGKYNPRATQHEFATRNPWYRLLVDDS
SQITYVEECQLLPDTSQEPINNPNIDDYLIKNKGSYQKAIPSH
Download sequence
Identical sequences A0A128PHK5 A0A1S8GFI7
297246.lpp2998 400673.LPC_3236 gi|397668611|ref|YP_006510148.1| gi|54298931|ref|YP_125300.1| gi|296108601|ref|YP_003620302.1| gi|148361262|ref|YP_001252469.1| WP_011947825.1.100609 WP_011947825.1.101326 WP_011947825.1.10632 WP_011947825.1.10829 WP_011947825.1.1173 WP_011947825.1.11786 WP_011947825.1.12039 WP_011947825.1.12916 WP_011947825.1.13050 WP_011947825.1.15769 WP_011947825.1.16040 WP_011947825.1.17092 WP_011947825.1.17548 WP_011947825.1.17681 WP_011947825.1.17809 WP_011947825.1.19781 WP_011947825.1.21168 WP_011947825.1.21504 WP_011947825.1.21543 WP_011947825.1.21849 WP_011947825.1.23 WP_011947825.1.24295 WP_011947825.1.24659 WP_011947825.1.25399 WP_011947825.1.25422 WP_011947825.1.25619 WP_011947825.1.27676 WP_011947825.1.28040 WP_011947825.1.2872 WP_011947825.1.28721 WP_011947825.1.28782 WP_011947825.1.29425 WP_011947825.1.29598 WP_011947825.1.29717 WP_011947825.1.30122 WP_011947825.1.30351 WP_011947825.1.3122 WP_011947825.1.31301 WP_011947825.1.32367 WP_011947825.1.3258 WP_011947825.1.32970 WP_011947825.1.34167 WP_011947825.1.34246 WP_011947825.1.34671 WP_011947825.1.35082 WP_011947825.1.35792 WP_011947825.1.35807 WP_011947825.1.36016 WP_011947825.1.36350 WP_011947825.1.37078 WP_011947825.1.37161 WP_011947825.1.37322 WP_011947825.1.37616 WP_011947825.1.37757 WP_011947825.1.38133 WP_011947825.1.38414 WP_011947825.1.38444 WP_011947825.1.39582 WP_011947825.1.41396 WP_011947825.1.41414 WP_011947825.1.41585 WP_011947825.1.42431 WP_011947825.1.43145 WP_011947825.1.44947 WP_011947825.1.45039 WP_011947825.1.46375 WP_011947825.1.46948 WP_011947825.1.47329 WP_011947825.1.47638 WP_011947825.1.47725 WP_011947825.1.48466 WP_011947825.1.48523 WP_011947825.1.48987 WP_011947825.1.49404 WP_011947825.1.49562 WP_011947825.1.50306 WP_011947825.1.50379 WP_011947825.1.50792 WP_011947825.1.51991 WP_011947825.1.52439 WP_011947825.1.52625 WP_011947825.1.52911 WP_011947825.1.53443 WP_011947825.1.5363 WP_011947825.1.54450 WP_011947825.1.54747 WP_011947825.1.5553 WP_011947825.1.56801 WP_011947825.1.58425 WP_011947825.1.58590 WP_011947825.1.5861 WP_011947825.1.58655 WP_011947825.1.59183 WP_011947825.1.6043 WP_011947825.1.60442 WP_011947825.1.61482 WP_011947825.1.62255 WP_011947825.1.62386 WP_011947825.1.6243 WP_011947825.1.63249 WP_011947825.1.63357 WP_011947825.1.63686 WP_011947825.1.64714 WP_011947825.1.64936 WP_011947825.1.65356 WP_011947825.1.65604 WP_011947825.1.6601 WP_011947825.1.6641 WP_011947825.1.6663 WP_011947825.1.66827 WP_011947825.1.66942 WP_011947825.1.66949 WP_011947825.1.67348 WP_011947825.1.68780 WP_011947825.1.68977 WP_011947825.1.69880 WP_011947825.1.71674 WP_011947825.1.72557 WP_011947825.1.72722 WP_011947825.1.728 WP_011947825.1.73276 WP_011947825.1.73409 WP_011947825.1.73575 WP_011947825.1.74052 WP_011947825.1.74197 WP_011947825.1.75016 WP_011947825.1.75926 WP_011947825.1.76246 WP_011947825.1.7695 WP_011947825.1.77227 WP_011947825.1.78899 WP_011947825.1.79331 WP_011947825.1.79423 WP_011947825.1.79768 WP_011947825.1.79852 WP_011947825.1.79957 WP_011947825.1.80208 WP_011947825.1.80246 WP_011947825.1.80464 WP_011947825.1.80679 WP_011947825.1.80844 WP_011947825.1.80921 WP_011947825.1.81040 WP_011947825.1.81849 WP_011947825.1.82004 WP_011947825.1.82012 WP_011947825.1.82883 WP_011947825.1.83690 WP_011947825.1.84032 WP_011947825.1.8407 WP_011947825.1.86175 WP_011947825.1.86462 WP_011947825.1.88749 WP_011947825.1.89129 WP_011947825.1.90773 WP_011947825.1.91040 WP_011947825.1.93995 WP_011947825.1.94262 WP_011947825.1.94483 WP_011947825.1.95613 WP_011947825.1.95686 WP_011947825.1.96370 WP_011947825.1.97870 WP_011947825.1.97946 WP_011947825.1.98579 WP_011947825.1.98841 WP_011947825.1.99481 WP_011947825.1.99767 WP_011947825.1.9980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]