SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397668055|ref|YP_006509592.1| from Legionella pneumophila subsp. pneumophila

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397668055|ref|YP_006509592.1|
Domain Number 1 Region: 310-391,420-605
Classification Level Classification E-value
Superfamily HAD-like 3.74e-31
Family Meta-cation ATPase, catalytic domain P 0.0043
Further Details:      
 
Domain Number 2 Region: 121-216
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.92e-17
Family Calcium ATPase, transduction domain A 0.012
Further Details:      
 
Domain Number 3 Region: 71-122,219-302
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000615
Family Calcium ATPase, transmembrane domain M 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397668055|ref|YP_006509592.1|
Sequence length 622
Comment Heavy metal translocating P-type ATPase [Legionella pneumophila subsp. pneumophila]
Sequence
MNYFFDAIKTKWQFWITIYSIIAIVLYIIMKIINVPYINVPLILIIIIGGLPLFIQISIK
LVQGDLGADTLAALSLITGVILHEYLAACLIILMLASGQTLEVYARRKASSVLQALISRM
PSKVHIRKNEQITDIPLSETQIGDEIIIYPHETCPVDGEVIDGHGTMDESYLTGEPYLIA
KAPGVTVLSGAINGEALLVVKASKRPSDSRYAAIVEVLKEAEQKKPTLRRLGDQIGAIFT
PIALFFALLAWYFSGDPIRFLSVLVIATPCPLLIAIPITIISAVSMAAKQAIIIKDPTIL
ERLPTCQTAIFDKTGTLTYGKPTLTKIITTETYSHSDILQYAASLERYSKHPLSNSILDA
AKERGLTLLQASEVFEKPGQGLLGKINDHSVQVTSRKKFLAKHPEEVGFLPEHSSGLECL
ILIDEQFAAVLQFHDAPREESHSFIHHLAPSHQFKKIMLVSGDRESEVKYLGKLLELTEI
YSSQSPEQKLKIVRDETRKAPTLYMGDGINDAPALTAATVGIAFGQYSNVTAEAAGAVIM
ENTLNKVDELMHLSINTRKIALQSAIGGMLLSIIGMSFAALGFINPVTGAILQELIDILA
IINALQLTWGSRVKIDLPGYKA
Download sequence
Identical sequences A0A1P8N8U0
gi|397668055|ref|YP_006509592.1| WP_014844537.1.1206 WP_014844537.1.17430 WP_014844537.1.23 WP_014844537.1.24881 WP_014844537.1.25422 WP_014844537.1.30122 WP_014844537.1.34671 WP_014844537.1.37792 WP_014844537.1.47329 WP_014844537.1.49404 WP_014844537.1.51024 WP_014844537.1.51991 WP_014844537.1.5252 WP_014844537.1.59692 WP_014844537.1.74052 WP_014844537.1.76246 WP_014844537.1.87225 WP_014844537.1.9568 WP_014844537.1.97528 WP_014844537.1.98163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]