SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|511061185|ref|YP_008076503.1| from Bacillus licheniformis 9945A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511061185|ref|YP_008076503.1|
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.06e-36
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|511061185|ref|YP_008076503.1|
Sequence length 110
Comment lichenan-specific phosphotransferase system EIIA component LicA [Bacillus licheniformis 9945A]
Sequence
MADTLQLEQVSFEIILHAGNARSSAMEALQLVKQHEWETGYQKIQEAESELSQAHQAQTR
LLQKEAQGEGLSPNLLLIHAQDHLMTAMTVKDLAKELIHLYQELQKGREK
Download sequence
Identical sequences A0A0D7XFA2 A0A1Q8GU14 R9TQ25
gi|511061185|ref|YP_008076503.1| WP_020450044.1.100763 WP_020450044.1.17986 WP_020450044.1.21808 WP_020450044.1.25580 WP_020450044.1.26113 WP_020450044.1.36620 WP_020450044.1.36854 WP_020450044.1.36860 WP_020450044.1.42174 WP_020450044.1.47125 WP_020450044.1.74801 WP_020450044.1.75289 WP_020450044.1.80397 WP_020450044.1.82679 WP_020450044.1.83084 WP_020450044.1.97335 WP_020450044.1.98137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]