SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|511063626|ref|YP_008078944.1| from Bacillus licheniformis 9945A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511063626|ref|YP_008078944.1|
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.1e-30
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|511063626|ref|YP_008078944.1|
Sequence length 117
Comment putative lactose/cellobiose-specific phosphotransferase enzyme IIA component [Bacillus licheniformis 9945A]
Sequence
MVDREKEQEALNLVSMQMILHAGDARNDVMEALKCCEEENYDRAEELLEKANKDIVASHK
LQTETVQKEARGEEPIFSLLFAHAQDTLMTVKSEYEIAKRLVRVFRRLDEKIDGMQA
Download sequence
Identical sequences A0A0D7XHX3 R9TZZ0
gi|511063626|ref|YP_008078944.1| WP_020452293.1.17986 WP_020452293.1.25580 WP_020452293.1.26113 WP_020452293.1.74801 WP_020452293.1.83084 WP_020452293.1.97335 WP_020452293.1.98137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]