SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|511064827|ref|YP_008080145.1| from Bacillus licheniformis 9945A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|511064827|ref|YP_008080145.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.57e-37
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|511064827|ref|YP_008080145.1|
Sequence length 109
Comment lichenan-specific phosphotransferase system EIIA component LicA [Bacillus licheniformis 9945A]
Sequence
MSEELERTIFQIILHGGNGRSFCMEAIAEAKKGDFAAAKEKIRAADEELIKAHHFQTALI
QNEAKGAKTEPSLLMIHAQDHLMNAMTMKDLAAEIVELYEKMNVHGGVN
Download sequence
Identical sequences A0A0D7XJY2 A0A1Q8GYF7 R9U004
gi|511064827|ref|YP_008080145.1| WP_020453402.1.100763 WP_020453402.1.17986 WP_020453402.1.21808 WP_020453402.1.26113 WP_020453402.1.36620 WP_020453402.1.36854 WP_020453402.1.36860 WP_020453402.1.42174 WP_020453402.1.47125 WP_020453402.1.74801 WP_020453402.1.75289 WP_020453402.1.80397 WP_020453402.1.82128 WP_020453402.1.82679 WP_020453402.1.83084 WP_020453402.1.97335 WP_020453402.1.98137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]