SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126641119|ref|YP_001084103.1| from Acinetobacter baumannii ATCC 17978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126641119|ref|YP_001084103.1|
Domain Number 1 Region: 1-339
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.36e-99
Family FMN-linked oxidoreductases 0.0000000139
Further Details:      
 
Domain Number 2 Region: 311-495
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.88e-40
Family N-terminal domain of adrenodoxin reductase-like 0.0000212
Further Details:      
 
Domain Number 3 Region: 447-607
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000139
Family C-terminal domain of adrenodoxin reductase-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126641119|ref|YP_001084103.1|
Sequence length 653
Comment 24-dienoyl-CoA reductase [Acinetobacter baumannii ATCC 17978]
Sequence
MGSMHTGLEDRFFNYPKLAAYFEERAKGGVGLIVTGGISPNRQGWLAPAGGTMNSLFDIP
QHRLVTHAVHKHGSKILMQILHAGRYGYQPFVVSSSAIKSPISPFKPRQLSEKNILSTIE
DYAQCADIAKKAGYDGVEIMGSEGYLINQFLSRHVNQRTDCWGGEIENRMRFPVEIVKAI
RAKVGEKFIICFRLSLLDLVHDGNTMQEVVTVAKALEKAGVTLLNTGIGWHEARVPTIVT
SVPRAAFVDYTAHVKQHISIPVIASNRINMPETAEEILATGKADMIQMARPLLADAFWVN
KTATNRVDEINTCIACNQACLDHAFKNKRVSCLVNPRAGHETELVYLKTKQPKRIAVVGG
GVAGMSAATVAASRGHAVTLFEANADVGGQFNFAKVVPGKEEFHETIRYFKVQLQKTGVD
VRLNTRVNREQLEREGFDEVIVATGVVPRALKIEGSNSPQVLSYAQVLQGAEVGRKVAVI
GAGGIGFDVSEFLLKPPHQPQPQPLAEWQCEWGVDPDPNYVSEGGMQPPVVEPAIREIYL
LQRKTTPLGIGLGKTSGWVHRAQLKKHGVRMLRGVQYKAVTDEGLWIEHNGQDQLLRVDT
VVVCAGQESVKDLMPKEGESTIANYHIIGGAKLAAELDAKRAIKEGAELAARL
Download sequence
Identical sequences gi|126641119|ref|YP_001084103.1| 400667.A1S_1070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]