SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126641950|ref|YP_001084934.1| from Acinetobacter baumannii ATCC 17978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126641950|ref|YP_001084934.1|
Domain Number 1 Region: 1-340
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.31e-102
Family FMN-linked oxidoreductases 0.00000000422
Further Details:      
 
Domain Number 2 Region: 311-499
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.88e-39
Family N-terminal domain of adrenodoxin reductase-like 0.0000107
Further Details:      
 
Domain Number 3 Region: 442-499,535-629
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.48e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126641950|ref|YP_001084934.1|
Sequence length 651
Comment 24-dienoyl-CoA reductase [Acinetobacter baumannii ATCC 17978]
Sequence
MGSMHVGLEEAPGGYERMAAFYAERAKGDVGLIVTGGIAPNQAGLTFAHASKLDSTEEAE
KHKVITEAVHAAGGKIALQILHTGRYSYQPEIVAPSAIQAPINPIKPKAMTSAEVQQTID
DFANCAKLAQYAGYDGVEIMGSEGYLINEFIAARTNHRDDEWGGSYENRIRFPVEIVKRT
REIVGENFIIIYRLSMLDLVEGGSTLEEVIQLAKAIEKAGATIINTGIGWHEARIPTIAT
KVPRAAFTWVTEKLKGEVSVPLITSNRINTPEMAEHVLASDHADMVSMARPMLADPDFVL
KASEGRSDEINTCIGCNQACLDHIFSMKIATCLVNPRACYETELIFKEAQNQKNIAVIGA
GPAGLSFAVYAADRGHQVKIFEASHQIGGQFNIAKTVPGKEEFYETLRYFNRQIELRPNI
ELVLNHPATYEELSQSDFDEIVVATGVTPRQLQFEGIDHPKVLSYLQVLKERVAVGQRVA
IIGAGGIGFDTAEYLTHEGESGSLNPEKFYEEWGIDTHYEHVGGLKQPKVEASEREIYLL
QRKASSVGAGLGKTTGWIHRTGLKNRNVKMLAGVQYDKVDDQGLHITVDGKPTVLEVDNV
VICAGQESFTAMYDQLKADGKNVHLIGGAKEAGELDAKRAIRQGAELAAVI
Download sequence
Identical sequences 400667.A1S_1905 gi|126641950|ref|YP_001084934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]