SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126642836|ref|YP_001085820.1| from Acinetobacter baumannii ATCC 17978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126642836|ref|YP_001085820.1|
Domain Number 1 Region: 321-623
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.09e-70
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126642836|ref|YP_001085820.1|
Sequence length 625
Comment methyl-accepting chemotaxis protein [Acinetobacter baumannii ATCC 17978]
Sequence
MPRHNQLIRSLGELRLLSQTISKQATEATESGSQEAITKLQQSKKDFDENLLEIENIHGK
STDEYQKVEKIWGEVSKNIDLISSHQRVLNQLYDTNISISETVPEIQAEYNLMVDQMARQ
GLPSSQVIIAKNQVFIAERILRSINSVLSGTDGNVSTSDFSVDIETFGTYLNAELNGNAE
LGVDRIADPALRESLESIKSEYDKVLKSAAATVLKNGSQIVNVRQASSQIFSKSDVMLES
LGHLSDVARKNWLTLFLGAVLILSLGGLIFSVFKLITLRSVMDKQRVARLQEEYDRNQNA
ILRLLDEIADLADGDLRSYATVSEDFTGAIADSINFAIDQLRDLVSRIHETSQEVARYTQ
DTQSITNQLAEASEHQAQEIAGASTAMNEMAQSIDQVSANASESAEVAQRSVQIASNGAQ
VVNRSIEGMDTIREQIQETSKRIKRLGESSQEIGNIVSLINDIADQTNILALNAAIQASM
AGEAGRGFAVVADEVQRLAERSASATKQIETLVKTIQTDTNEAVISMEQTTTEVVRGANL
AKDAGIALDEIQKVSGDLAKLIASISDAAKLQSASASHIATTMTVVQEITSQTTTATFDT
ARSVSELANMAESLRESVTDFKLPD
Download sequence
Identical sequences 400667.A1S_2812 gi|126642836|ref|YP_001085820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]