SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|126641943|ref|YP_001084927.1| from Acinetobacter baumannii ATCC 17978

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126641943|ref|YP_001084927.1|
Domain Number 1 Region: 112-386
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.05e-125
Family Enolase 0.00000000979
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.74e-41
Family Enolase N-terminal domain-like 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126641943|ref|YP_001084927.1|
Sequence length 399
Comment phosphopyruvate hydratase [Acinetobacter baumannii ATCC 17978]
Sequence
MVGRACAPSGASTGSREALELRDGDKSRYLGKGVRTAVQNVNSSIHELLVGQSVFEQKAL
DEKMIAFDGTENKSKLGANATLAVSLAAAHAAAAEQKLPLFQYIANLRGQTTLTMPVPMM
NILNGGAHADNTVDIQEFMIEPVGFTSFAEALRAGAEVFHSLKSVLKKQGLNTAVGDEGG
FAPNLRSNEEAITVILQAIEQTGYKAGSDIMLALDCASSEFYKNGQYILEGEGNKSFTSN
QFADYLAGLVKQYPIISIEDGLDESDWEGWSYLTSILGDKIQLVGDDLFVTNPKILQRGI
DEKVGNSILIKYNQIGTLTETLDAIYLAKANGYTTVISHRSGETEDSTIADLAVGTAAGQ
IKTGSLCRSDRVSKYNQLLRIEELTKAVYRGKAEFKGLN
Download sequence
Identical sequences gi|126641943|ref|YP_001084927.1| 400667.A1S_1898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]