SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121599055|ref|YP_994540.1| from Burkholderia mallei SAVP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121599055|ref|YP_994540.1|
Domain Number 1 Region: 21-288
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.02e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000192
Further Details:      
 
Domain Number 2 Region: 289-313,359-443
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 9.35e-22
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121599055|ref|YP_994540.1|
Sequence length 460
Comment ubiquinol-cytochrome c reductase, cytochrome b [Burkholderia mallei SAVP1]
Sequence
MATDNKEISTTGLLGWVDRRFPLTSTWKQHLSEYYAPKNFNVWYFFGSLALLVLVNQIVT
GIFLTMNYKPDSTLAFASVEYIMREVPWGWLIRYLHSTGASMFFVVVYLHMFRGLLYGSY
RKPRELVWIFGCAIFLCLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPFVGPDLSLWIR
GDYVVSDVTLNRFFAFHVIAIPLVLLLLVVAHLIALHEVGSNNPDGIEIKEKKDEKGVPL
DGIPFHPYYSVHDFFGVCVFLMVFALIVFFMPEMGGYFLEANNFIPANPLQTPPEIAPVW
YFTAFYAMLRATTDPFKIVLMIVIAALGLLALVRARGKWKIALPVLAAALVVFMYFTESK
FWGVVVMGGAVVTLFFLPWLDRSPVKSIRYRPFFHKVFFGIFVVVFLTLAFLGTRPPSPA
ATLIAQVCALVYFAFFLGMPFWTPLGTFKQPPERVRFKSH
Download sequence
Identical sequences A0A069B949 A0A0E1S3M9 A0A0E1TQM9 A0A0E1UH74 A0A0E1WBE2 A0A0F6LES7 A0A0H2WGG0 A0A0H3HSU4 A0A290YCD4 A0A2K3ERB1 A0A2K3G1V6 A0A2K3H7U8 A0A2K3HSQ9 A2S766 A3NE82 A3P015 C4AVX7 C4KWM7 Q3JN15 Q63QA3
gi|124385101|ref|YP_001027785.1| gi|403520371|ref|YP_006654505.1| gi|126453900|ref|YP_001067936.1| gi|526470788|ref|YP_008342416.1| gi|237814048|ref|YP_002898499.1| gi|386863379|ref|YP_006276328.1| gi|53724249|ref|YP_104218.1| gi|126440491|ref|YP_001060653.1| gi|121599055|ref|YP_994540.1| gi|76811440|ref|YP_335038.1| 243160.BMA2697 272560.BPSL3122 320372.BURPS1710b_3674 320373.BURPS668_3649 320388.BMASAVP1_A3257 320389.BMA10247_2747 357348.BURPS1106A_3706 412022.BMA10229_A1806 536230.GBP346_A3833 WP_004199894.1.100104 WP_004199894.1.100195 WP_004199894.1.10047 WP_004199894.1.100583 WP_004199894.1.100720 WP_004199894.1.100727 WP_004199894.1.100825 WP_004199894.1.100900 WP_004199894.1.1010 WP_004199894.1.101060 WP_004199894.1.101307 WP_004199894.1.101381 WP_004199894.1.101559 WP_004199894.1.101588 WP_004199894.1.101783 WP_004199894.1.102051 WP_004199894.1.10269 WP_004199894.1.10290 WP_004199894.1.10359 WP_004199894.1.10553 WP_004199894.1.10633 WP_004199894.1.10746 WP_004199894.1.10907 WP_004199894.1.1098 WP_004199894.1.11046 WP_004199894.1.11072 WP_004199894.1.11160 WP_004199894.1.11268 WP_004199894.1.11404 WP_004199894.1.11747 WP_004199894.1.11825 WP_004199894.1.11893 WP_004199894.1.11996 WP_004199894.1.11998 WP_004199894.1.1266 WP_004199894.1.12731 WP_004199894.1.12793 WP_004199894.1.12856 WP_004199894.1.12860 WP_004199894.1.13198 WP_004199894.1.13520 WP_004199894.1.13597 WP_004199894.1.13603 WP_004199894.1.13639 WP_004199894.1.13925 WP_004199894.1.13950 WP_004199894.1.14356 WP_004199894.1.14539 WP_004199894.1.14557 WP_004199894.1.1465 WP_004199894.1.14660 WP_004199894.1.15170 WP_004199894.1.15364 WP_004199894.1.15525 WP_004199894.1.15673 WP_004199894.1.15696 WP_004199894.1.16090 WP_004199894.1.16113 WP_004199894.1.16249 WP_004199894.1.16358 WP_004199894.1.16540 WP_004199894.1.16561 WP_004199894.1.16625 WP_004199894.1.16680 WP_004199894.1.16689 WP_004199894.1.16749 WP_004199894.1.17067 WP_004199894.1.17068 WP_004199894.1.17278 WP_004199894.1.17473 WP_004199894.1.17786 WP_004199894.1.18058 WP_004199894.1.18396 WP_004199894.1.18405 WP_004199894.1.18471 WP_004199894.1.18549 WP_004199894.1.18631 WP_004199894.1.18669 WP_004199894.1.18704 WP_004199894.1.18744 WP_004199894.1.18868 WP_004199894.1.18906 WP_004199894.1.19401 WP_004199894.1.19486 WP_004199894.1.19540 WP_004199894.1.19629 WP_004199894.1.1976 WP_004199894.1.19815 WP_004199894.1.19842 WP_004199894.1.19854 WP_004199894.1.20021 WP_004199894.1.20246 WP_004199894.1.20501 WP_004199894.1.20520 WP_004199894.1.20531 WP_004199894.1.20673 WP_004199894.1.20954 WP_004199894.1.21147 WP_004199894.1.21205 WP_004199894.1.21291 WP_004199894.1.21304 WP_004199894.1.21409 WP_004199894.1.21442 WP_004199894.1.21461 WP_004199894.1.21653 WP_004199894.1.21809 WP_004199894.1.21907 WP_004199894.1.22046 WP_004199894.1.22299 WP_004199894.1.22308 WP_004199894.1.22329 WP_004199894.1.2261 WP_004199894.1.22625 WP_004199894.1.22779 WP_004199894.1.23009 WP_004199894.1.23086 WP_004199894.1.23104 WP_004199894.1.23131 WP_004199894.1.2317 WP_004199894.1.23385 WP_004199894.1.23743 WP_004199894.1.23852 WP_004199894.1.23994 WP_004199894.1.24020 WP_004199894.1.24134 WP_004199894.1.24314 WP_004199894.1.24372 WP_004199894.1.24454 WP_004199894.1.24513 WP_004199894.1.2462 WP_004199894.1.24701 WP_004199894.1.25068 WP_004199894.1.25102 WP_004199894.1.25138 WP_004199894.1.25265 WP_004199894.1.25412 WP_004199894.1.25628 WP_004199894.1.25728 WP_004199894.1.259 WP_004199894.1.26054 WP_004199894.1.26445 WP_004199894.1.26502 WP_004199894.1.26535 WP_004199894.1.26565 WP_004199894.1.26633 WP_004199894.1.26645 WP_004199894.1.267 WP_004199894.1.26838 WP_004199894.1.26849 WP_004199894.1.27064 WP_004199894.1.27069 WP_004199894.1.27146 WP_004199894.1.27363 WP_004199894.1.27390 WP_004199894.1.27399 WP_004199894.1.27420 WP_004199894.1.27441 WP_004199894.1.27597 WP_004199894.1.2767 WP_004199894.1.27810 WP_004199894.1.27909 WP_004199894.1.28018 WP_004199894.1.28066 WP_004199894.1.28187 WP_004199894.1.28453 WP_004199894.1.28594 WP_004199894.1.28619 WP_004199894.1.28632 WP_004199894.1.29148 WP_004199894.1.29178 WP_004199894.1.29335 WP_004199894.1.29508 WP_004199894.1.29520 WP_004199894.1.29547 WP_004199894.1.29658 WP_004199894.1.29853 WP_004199894.1.29878 WP_004199894.1.29887 WP_004199894.1.29899 WP_004199894.1.29948 WP_004199894.1.30311 WP_004199894.1.30382 WP_004199894.1.3041 WP_004199894.1.30671 WP_004199894.1.3069 WP_004199894.1.30729 WP_004199894.1.30937 WP_004199894.1.30966 WP_004199894.1.31343 WP_004199894.1.31723 WP_004199894.1.31831 WP_004199894.1.32174 WP_004199894.1.32182 WP_004199894.1.32221 WP_004199894.1.3251 WP_004199894.1.32581 WP_004199894.1.3273 WP_004199894.1.32951 WP_004199894.1.33077 WP_004199894.1.33087 WP_004199894.1.33130 WP_004199894.1.33157 WP_004199894.1.33158 WP_004199894.1.33165 WP_004199894.1.332 WP_004199894.1.33366 WP_004199894.1.33419 WP_004199894.1.33493 WP_004199894.1.33543 WP_004199894.1.33573 WP_004199894.1.33779 WP_004199894.1.34230 WP_004199894.1.34333 WP_004199894.1.34393 WP_004199894.1.34564 WP_004199894.1.34747 WP_004199894.1.35025 WP_004199894.1.35052 WP_004199894.1.35090 WP_004199894.1.35141 WP_004199894.1.35227 WP_004199894.1.35249 WP_004199894.1.35474 WP_004199894.1.35485 WP_004199894.1.35491 WP_004199894.1.35757 WP_004199894.1.35825 WP_004199894.1.35878 WP_004199894.1.36106 WP_004199894.1.36174 WP_004199894.1.36259 WP_004199894.1.36527 WP_004199894.1.366 WP_004199894.1.36662 WP_004199894.1.36666 WP_004199894.1.36944 WP_004199894.1.37 WP_004199894.1.3706 WP_004199894.1.37373 WP_004199894.1.37428 WP_004199894.1.37446 WP_004199894.1.37517 WP_004199894.1.37519 WP_004199894.1.37535 WP_004199894.1.37581 WP_004199894.1.37622 WP_004199894.1.37627 WP_004199894.1.37690 WP_004199894.1.37702 WP_004199894.1.37725 WP_004199894.1.37806 WP_004199894.1.37934 WP_004199894.1.37959 WP_004199894.1.37994 WP_004199894.1.38115 WP_004199894.1.38442 WP_004199894.1.38490 WP_004199894.1.38683 WP_004199894.1.3872 WP_004199894.1.38810 WP_004199894.1.38946 WP_004199894.1.39078 WP_004199894.1.39162 WP_004199894.1.39179 WP_004199894.1.39349 WP_004199894.1.3947 WP_004199894.1.39595 WP_004199894.1.39757 WP_004199894.1.39898 WP_004199894.1.40021 WP_004199894.1.40045 WP_004199894.1.40191 WP_004199894.1.40235 WP_004199894.1.40275 WP_004199894.1.40388 WP_004199894.1.40390 WP_004199894.1.40426 WP_004199894.1.40448 WP_004199894.1.4077 WP_004199894.1.41477 WP_004199894.1.41588 WP_004199894.1.41945 WP_004199894.1.42408 WP_004199894.1.42496 WP_004199894.1.42800 WP_004199894.1.43136 WP_004199894.1.43156 WP_004199894.1.43373 WP_004199894.1.43542 WP_004199894.1.43587 WP_004199894.1.43678 WP_004199894.1.43727 WP_004199894.1.43786 WP_004199894.1.43899 WP_004199894.1.44179 WP_004199894.1.44234 WP_004199894.1.44352 WP_004199894.1.44414 WP_004199894.1.44540 WP_004199894.1.44824 WP_004199894.1.45284 WP_004199894.1.45348 WP_004199894.1.45356 WP_004199894.1.45537 WP_004199894.1.45715 WP_004199894.1.45890 WP_004199894.1.4631 WP_004199894.1.46575 WP_004199894.1.46757 WP_004199894.1.4693 WP_004199894.1.47086 WP_004199894.1.47564 WP_004199894.1.48093 WP_004199894.1.4810 WP_004199894.1.48313 WP_004199894.1.48407 WP_004199894.1.48464 WP_004199894.1.49026 WP_004199894.1.49717 WP_004199894.1.49872 WP_004199894.1.50174 WP_004199894.1.50320 WP_004199894.1.50336 WP_004199894.1.50636 WP_004199894.1.50788 WP_004199894.1.50839 WP_004199894.1.5105 WP_004199894.1.51606 WP_004199894.1.51666 WP_004199894.1.5173 WP_004199894.1.5182 WP_004199894.1.51874 WP_004199894.1.51891 WP_004199894.1.51902 WP_004199894.1.52229 WP_004199894.1.52365 WP_004199894.1.52407 WP_004199894.1.52451 WP_004199894.1.52547 WP_004199894.1.52643 WP_004199894.1.52655 WP_004199894.1.52731 WP_004199894.1.52760 WP_004199894.1.52882 WP_004199894.1.5292 WP_004199894.1.53034 WP_004199894.1.53048 WP_004199894.1.53103 WP_004199894.1.53132 WP_004199894.1.5338 WP_004199894.1.53386 WP_004199894.1.53506 WP_004199894.1.53578 WP_004199894.1.53977 WP_004199894.1.54016 WP_004199894.1.5413 WP_004199894.1.54312 WP_004199894.1.54369 WP_004199894.1.54804 WP_004199894.1.54859 WP_004199894.1.54892 WP_004199894.1.55038 WP_004199894.1.55415 WP_004199894.1.55691 WP_004199894.1.55755 WP_004199894.1.55974 WP_004199894.1.55996 WP_004199894.1.5608 WP_004199894.1.56126 WP_004199894.1.56248 WP_004199894.1.5641 WP_004199894.1.56458 WP_004199894.1.56591 WP_004199894.1.56744 WP_004199894.1.56949 WP_004199894.1.56993 WP_004199894.1.57046 WP_004199894.1.57096 WP_004199894.1.57247 WP_004199894.1.5734 WP_004199894.1.57341 WP_004199894.1.57359 WP_004199894.1.57679 WP_004199894.1.5776 WP_004199894.1.58003 WP_004199894.1.58105 WP_004199894.1.58190 WP_004199894.1.58355 WP_004199894.1.58362 WP_004199894.1.58390 WP_004199894.1.58405 WP_004199894.1.58509 WP_004199894.1.58523 WP_004199894.1.58578 WP_004199894.1.58639 WP_004199894.1.58758 WP_004199894.1.5883 WP_004199894.1.59103 WP_004199894.1.59200 WP_004199894.1.59255 WP_004199894.1.59422 WP_004199894.1.59496 WP_004199894.1.59519 WP_004199894.1.59536 WP_004199894.1.59549 WP_004199894.1.59747 WP_004199894.1.60398 WP_004199894.1.60769 WP_004199894.1.60810 WP_004199894.1.60833 WP_004199894.1.60836 WP_004199894.1.60969 WP_004199894.1.61073 WP_004199894.1.61084 WP_004199894.1.61202 WP_004199894.1.61455 WP_004199894.1.61588 WP_004199894.1.61685 WP_004199894.1.61723 WP_004199894.1.61854 WP_004199894.1.6186 WP_004199894.1.61900 WP_004199894.1.62103 WP_004199894.1.62183 WP_004199894.1.62774 WP_004199894.1.63097 WP_004199894.1.63261 WP_004199894.1.63361 WP_004199894.1.63379 WP_004199894.1.63439 WP_004199894.1.63505 WP_004199894.1.63661 WP_004199894.1.63719 WP_004199894.1.63942 WP_004199894.1.64068 WP_004199894.1.64096 WP_004199894.1.64166 WP_004199894.1.64204 WP_004199894.1.64364 WP_004199894.1.64383 WP_004199894.1.64542 WP_004199894.1.64683 WP_004199894.1.64892 WP_004199894.1.65093 WP_004199894.1.65270 WP_004199894.1.65468 WP_004199894.1.65832 WP_004199894.1.65994 WP_004199894.1.66321 WP_004199894.1.66380 WP_004199894.1.66465 WP_004199894.1.66594 WP_004199894.1.67013 WP_004199894.1.67117 WP_004199894.1.67182 WP_004199894.1.67229 WP_004199894.1.67393 WP_004199894.1.67559 WP_004199894.1.6765 WP_004199894.1.67860 WP_004199894.1.67909 WP_004199894.1.67914 WP_004199894.1.67978 WP_004199894.1.6835 WP_004199894.1.68353 WP_004199894.1.68515 WP_004199894.1.68664 WP_004199894.1.68886 WP_004199894.1.68922 WP_004199894.1.69022 WP_004199894.1.69081 WP_004199894.1.69094 WP_004199894.1.69106 WP_004199894.1.69169 WP_004199894.1.69217 WP_004199894.1.69337 WP_004199894.1.69354 WP_004199894.1.69508 WP_004199894.1.69770 WP_004199894.1.69918 WP_004199894.1.70016 WP_004199894.1.7006 WP_004199894.1.70066 WP_004199894.1.70096 WP_004199894.1.70278 WP_004199894.1.70735 WP_004199894.1.71444 WP_004199894.1.71564 WP_004199894.1.71901 WP_004199894.1.72015 WP_004199894.1.72545 WP_004199894.1.72798 WP_004199894.1.72817 WP_004199894.1.73317 WP_004199894.1.73418 WP_004199894.1.73521 WP_004199894.1.73576 WP_004199894.1.73974 WP_004199894.1.74177 WP_004199894.1.74425 WP_004199894.1.7450 WP_004199894.1.74569 WP_004199894.1.74675 WP_004199894.1.74690 WP_004199894.1.75001 WP_004199894.1.75075 WP_004199894.1.75230 WP_004199894.1.75276 WP_004199894.1.75519 WP_004199894.1.75677 WP_004199894.1.75708 WP_004199894.1.75711 WP_004199894.1.75861 WP_004199894.1.75883 WP_004199894.1.75913 WP_004199894.1.75937 WP_004199894.1.76142 WP_004199894.1.76290 WP_004199894.1.76432 WP_004199894.1.76522 WP_004199894.1.76575 WP_004199894.1.766 WP_004199894.1.7703 WP_004199894.1.77249 WP_004199894.1.77287 WP_004199894.1.77319 WP_004199894.1.77689 WP_004199894.1.77788 WP_004199894.1.77845 WP_004199894.1.78029 WP_004199894.1.78278 WP_004199894.1.78506 WP_004199894.1.78557 WP_004199894.1.78628 WP_004199894.1.78759 WP_004199894.1.78807 WP_004199894.1.78827 WP_004199894.1.79052 WP_004199894.1.79360 WP_004199894.1.795 WP_004199894.1.79653 WP_004199894.1.79689 WP_004199894.1.79710 WP_004199894.1.79725 WP_004199894.1.79782 WP_004199894.1.80098 WP_004199894.1.80302 WP_004199894.1.80395 WP_004199894.1.80433 WP_004199894.1.80614 WP_004199894.1.80923 WP_004199894.1.81042 WP_004199894.1.8126 WP_004199894.1.81479 WP_004199894.1.81543 WP_004199894.1.81665 WP_004199894.1.82197 WP_004199894.1.82283 WP_004199894.1.82323 WP_004199894.1.82394 WP_004199894.1.82506 WP_004199894.1.82575 WP_004199894.1.82694 WP_004199894.1.82727 WP_004199894.1.82915 WP_004199894.1.82950 WP_004199894.1.83080 WP_004199894.1.83357 WP_004199894.1.8341 WP_004199894.1.83487 WP_004199894.1.83543 WP_004199894.1.83567 WP_004199894.1.83609 WP_004199894.1.83688 WP_004199894.1.8388 WP_004199894.1.8390 WP_004199894.1.8395 WP_004199894.1.83967 WP_004199894.1.84002 WP_004199894.1.84026 WP_004199894.1.84063 WP_004199894.1.84181 WP_004199894.1.84375 WP_004199894.1.84379 WP_004199894.1.84480 WP_004199894.1.84654 WP_004199894.1.84866 WP_004199894.1.85170 WP_004199894.1.85412 WP_004199894.1.85443 WP_004199894.1.85467 WP_004199894.1.85490 WP_004199894.1.85565 WP_004199894.1.85584 WP_004199894.1.856 WP_004199894.1.85641 WP_004199894.1.85645 WP_004199894.1.85774 WP_004199894.1.8585 WP_004199894.1.8629 WP_004199894.1.86295 WP_004199894.1.86438 WP_004199894.1.86525 WP_004199894.1.86806 WP_004199894.1.86872 WP_004199894.1.8697 WP_004199894.1.87114 WP_004199894.1.87278 WP_004199894.1.87324 WP_004199894.1.87553 WP_004199894.1.87652 WP_004199894.1.87759 WP_004199894.1.87811 WP_004199894.1.88003 WP_004199894.1.88117 WP_004199894.1.88237 WP_004199894.1.88322 WP_004199894.1.88369 WP_004199894.1.88411 WP_004199894.1.88666 WP_004199894.1.88682 WP_004199894.1.88764 WP_004199894.1.88920 WP_004199894.1.89093 WP_004199894.1.8912 WP_004199894.1.89240 WP_004199894.1.89435 WP_004199894.1.89514 WP_004199894.1.89782 WP_004199894.1.90079 WP_004199894.1.90471 WP_004199894.1.9079 WP_004199894.1.90934 WP_004199894.1.91025 WP_004199894.1.91142 WP_004199894.1.91198 WP_004199894.1.91700 WP_004199894.1.91709 WP_004199894.1.91763 WP_004199894.1.91823 WP_004199894.1.92095 WP_004199894.1.9236 WP_004199894.1.92406 WP_004199894.1.92430 WP_004199894.1.92493 WP_004199894.1.92507 WP_004199894.1.9280 WP_004199894.1.9281 WP_004199894.1.92904 WP_004199894.1.93844 WP_004199894.1.93845 WP_004199894.1.94023 WP_004199894.1.94050 WP_004199894.1.94117 WP_004199894.1.94121 WP_004199894.1.94403 WP_004199894.1.94498 WP_004199894.1.94520 WP_004199894.1.9479 WP_004199894.1.94901 WP_004199894.1.94926 WP_004199894.1.95054 WP_004199894.1.95300 WP_004199894.1.95339 WP_004199894.1.9537 WP_004199894.1.95420 WP_004199894.1.95587 WP_004199894.1.95644 WP_004199894.1.95672 WP_004199894.1.95938 WP_004199894.1.95952 WP_004199894.1.96381 WP_004199894.1.96660 WP_004199894.1.97058 WP_004199894.1.97112 WP_004199894.1.97148 WP_004199894.1.97989 WP_004199894.1.98066 WP_004199894.1.98218 WP_004199894.1.98316 WP_004199894.1.98491 WP_004199894.1.98547 WP_004199894.1.98688 WP_004199894.1.98713 WP_004199894.1.98753 WP_004199894.1.98768 WP_004199894.1.98944 WP_004199894.1.99061 WP_004199894.1.99069 WP_004199894.1.99160 WP_004199894.1.99233 WP_004199894.1.99290 WP_004199894.1.9962 WP_004199894.1.99629 WP_004199894.1.99741 WP_004199894.1.9975 WP_004199894.1.9983 WP_004199894.1.99890 WP_004199894.1.99919 YP_104218.1.87047 YP_109715.1.59693 gi|53720729|ref|YP_109715.1| gi|556576791|ref|YP_008744333.1| gi|126448939|ref|YP_001082268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]