SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121599750|ref|YP_994624.1| from Burkholderia mallei SAVP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121599750|ref|YP_994624.1|
Domain Number 1 Region: 647-1098
Classification Level Classification E-value
Superfamily ALDH-like 7.33e-127
Family ALDH-like 0.000000304
Further Details:      
 
Domain Number 2 Region: 258-606
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.96e-120
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000596
Further Details:      
 
Domain Number 3 Region: 88-257
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 4.18e-64
Family N-terminal domain of bifunctional PutA protein 0.000000408
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000000005
Family PutA pre-N-terminal region-like 0.001
Further Details:      
 
Domain Number 5 Region: 1143-1292
Classification Level Classification E-value
Superfamily ALDH-like 0.0000017
Family ALDH-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121599750|ref|YP_994624.1|
Sequence length 1309
Comment trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Burkholderia mallei SAVP1]
Sequence
MASTTLGVKVDDLLRARLKDAASRLERTPHWLIKQAIFAYLERIEHGQLPPELSGHTGVT
DLSDSHADGDDDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPECVPFLIGEARLPASL
ASDVQAMAAGLVEALREKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDAL
IRDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRLIGKGGEPLI
RKGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASY
EQAIHAIGKAAGGRGIYEGPGISIKLSALHARYSRSQQERTMNELLPRVRSLALLARRYD
IGLNIDAEEADRLELSLDLLEALCFDPELAGWNGIGFVVQAYQKRCPFVIDYLVDLARRS
RHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLAAPDAVYPQF
ATHNAYTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHE
TLLAYLVRRLLENGANTSFVNRIADKTVSVKELVADPVEDALKVVPLGAPHAKIALPREL
YGASRVNSMGLDLSNEHRLASLSSALLASAHHPWRAAPMLADDALAHAAPRDVRNPADLR
DVVGTVSEATPDEVSAALAHAVAAAPIWQATPVDARADCLARAADLLEAQMHTLMGLIVR
EAGKSLPNAIAEIREAVDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVA
AALAAGNTVLAKPAEQTPLIAAQAVRLLRDAGVPAGAVQLLPGNGETVGAALVADPRTRA
VMFTGSTEVARLINKTLSSRLDPDGRPIPLIAETGGQNAMIVDSSALAEQVVADVLQSSF
DSAGQRCSALRVLCLQDDVADRTLTMLKGAMRELALGNPDRLSVDVGPVIDADAKRTIDT
HIAAMKDKGHAVTQLEMPDACAQGTFVPPTIIEIGNVDELKREVFGPVLHVVRYRRSGLD
KLLEQIRATGYGLTLGIHTRIDETIAHVISRAHVGNIYVNRNVIGAVVGVQPFGGEGLSG
TGPKAGGALYLQRLLATRPAGLPRSLEAALVADAPQEGETRDNPSAALTALRDWLIEQRE
PALAARCDGYLSHVLAGATAVLSGPTGERNTYTLGARGTVLCIAATASGARAQFAAALAT
GNRALFAGAAGEALAAALPAQLKAHAGVRKQADAAFDAVLFEGDSDELLALVKEVAQRPG
PIVSVQGVAAGAFENGGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences A0A0E1S8P8 A0A0H2WEV7 A0A290YD13 A2S6I7 C4AQV1
gi|126449896|ref|YP_001082546.1| gi|124384431|ref|YP_001027556.1| gi|53724023|ref|YP_104469.1| gi|121599750|ref|YP_994624.1| 243160.BMA2965 320388.BMASAVP1_A3345 320389.BMA10247_3026 412022.BMA10229_A1576 gi|526471524|ref|YP_008342143.1| WP_004195842.1.100104 WP_004195842.1.100727 WP_004195842.1.101060 WP_004195842.1.101307 WP_004195842.1.11747 WP_004195842.1.13925 WP_004195842.1.15673 WP_004195842.1.16090 WP_004195842.1.20531 WP_004195842.1.20673 WP_004195842.1.20954 WP_004195842.1.21442 WP_004195842.1.21653 WP_004195842.1.22308 WP_004195842.1.22329 WP_004195842.1.22625 WP_004195842.1.22779 WP_004195842.1.23131 WP_004195842.1.23385 WP_004195842.1.25265 WP_004195842.1.28453 WP_004195842.1.29148 WP_004195842.1.31723 WP_004195842.1.31831 WP_004195842.1.3251 WP_004195842.1.33419 WP_004195842.1.33543 WP_004195842.1.34333 WP_004195842.1.34747 WP_004195842.1.35878 WP_004195842.1.37934 WP_004195842.1.37959 WP_004195842.1.38946 WP_004195842.1.39349 WP_004195842.1.40191 WP_004195842.1.40426 WP_004195842.1.4077 WP_004195842.1.41477 WP_004195842.1.41945 WP_004195842.1.43678 WP_004195842.1.43899 WP_004195842.1.44540 WP_004195842.1.44824 WP_004195842.1.4810 WP_004195842.1.48313 WP_004195842.1.48407 WP_004195842.1.5182 WP_004195842.1.52547 WP_004195842.1.53977 WP_004195842.1.54892 WP_004195842.1.55038 WP_004195842.1.55691 WP_004195842.1.55755 WP_004195842.1.56744 WP_004195842.1.57046 WP_004195842.1.57679 WP_004195842.1.61073 WP_004195842.1.61588 WP_004195842.1.61685 WP_004195842.1.63261 WP_004195842.1.63439 WP_004195842.1.63719 WP_004195842.1.64068 WP_004195842.1.66321 WP_004195842.1.66380 WP_004195842.1.66594 WP_004195842.1.67393 WP_004195842.1.68353 WP_004195842.1.68664 WP_004195842.1.69169 WP_004195842.1.69508 WP_004195842.1.72545 WP_004195842.1.72798 WP_004195842.1.7450 WP_004195842.1.74675 WP_004195842.1.75230 WP_004195842.1.75708 WP_004195842.1.75861 WP_004195842.1.77845 WP_004195842.1.78506 WP_004195842.1.78557 WP_004195842.1.79360 WP_004195842.1.79653 WP_004195842.1.82283 WP_004195842.1.82506 WP_004195842.1.84063 WP_004195842.1.84480 WP_004195842.1.85443 WP_004195842.1.8585 WP_004195842.1.89093 WP_004195842.1.92493 WP_004195842.1.92507 WP_004195842.1.9281 WP_004195842.1.93845 WP_004195842.1.94403 WP_004195842.1.94498 WP_004195842.1.9479 WP_004195842.1.95339 WP_004195842.1.95952 WP_004195842.1.97148 WP_004195842.1.98066 WP_004195842.1.9975 WP_004195842.1.99919 YP_104469.1.87047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]