SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121600913|ref|YP_994693.1| from Burkholderia mallei SAVP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121600913|ref|YP_994693.1|
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.33e-99
Family Methylenetetrahydrofolate reductase 0.000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121600913|ref|YP_994693.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Burkholderia mallei SAVP1]
Sequence
MNPIELSFEFFPPKTAEGVDKLRATRAQLAPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
AGLEAAPHLSCIGSSKDSLRAILDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFRIEVAAYPEYHPQARSPKADLENFARKVKAGANAAITQYFYNADAYFRFVD
DAAKLGVDVPVVPGIMPITNFSQLMRFSEMCGAEVPRWVARRLESFGDDKDSIRAFGADV
VTGLCRRLIDAGVPGLHFYTLNGAAATKTVCERLGL
Download sequence
Identical sequences A0A069B5T4 A0A0E1TSS6 A0A0E1UUX1 A0A0E1W171 A0A0F6GJD8 A0A0F6L767 A0A0H2WGJ7 A0A0H3HQB3 A0A290YCK0 A0A2K3F385 A0A2K3G589 A0A2K3HB63 A0A2K3I115 A2S6W4 A3NEQ9 A3P0L6 A8EH20 B1HA75 C4B1X2 C4KXI8 Q3JY81 Q63PT4
gi|124385348|ref|YP_001027683.1| gi|403520558|ref|YP_006654692.1| 243160.BMA2840 272560.BPSL3288 320372.BURPS1710b_0055 320373.BURPS668_3836 320388.BMASAVP1_A3415 320389.BMA10247_3136 357348.BURPS1106A_3917 412022.BMA10229_A1703 536230.GBP346_A4022 gi|237814227|ref|YP_002898678.1| gi|386863541|ref|YP_006276490.1| gi|126454447|ref|YP_001068137.1| gi|126451436|ref|YP_001082655.1| gi|126438559|ref|YP_001060830.1| gi|121600913|ref|YP_994693.1| gi|556574951|ref|YP_008744169.1| gi|53724305|ref|YP_104351.1| gi|76811025|ref|YP_331472.1| gi|53720898|ref|YP_109884.1| WP_004198631.1.100104 WP_004198631.1.100195 WP_004198631.1.10047 WP_004198631.1.100583 WP_004198631.1.100720 WP_004198631.1.100727 WP_004198631.1.100825 WP_004198631.1.100900 WP_004198631.1.1010 WP_004198631.1.101060 WP_004198631.1.101381 WP_004198631.1.101559 WP_004198631.1.101588 WP_004198631.1.101783 WP_004198631.1.102051 WP_004198631.1.10269 WP_004198631.1.10290 WP_004198631.1.10359 WP_004198631.1.10553 WP_004198631.1.10633 WP_004198631.1.10746 WP_004198631.1.10907 WP_004198631.1.1098 WP_004198631.1.11046 WP_004198631.1.11072 WP_004198631.1.11160 WP_004198631.1.11268 WP_004198631.1.11404 WP_004198631.1.11747 WP_004198631.1.11825 WP_004198631.1.11893 WP_004198631.1.11996 WP_004198631.1.11998 WP_004198631.1.1266 WP_004198631.1.12731 WP_004198631.1.12793 WP_004198631.1.12856 WP_004198631.1.12860 WP_004198631.1.13198 WP_004198631.1.13309 WP_004198631.1.13504 WP_004198631.1.13520 WP_004198631.1.13597 WP_004198631.1.13603 WP_004198631.1.13639 WP_004198631.1.13925 WP_004198631.1.13950 WP_004198631.1.14356 WP_004198631.1.14539 WP_004198631.1.14557 WP_004198631.1.1465 WP_004198631.1.14660 WP_004198631.1.15170 WP_004198631.1.15364 WP_004198631.1.15525 WP_004198631.1.15673 WP_004198631.1.15696 WP_004198631.1.16113 WP_004198631.1.16249 WP_004198631.1.16358 WP_004198631.1.16540 WP_004198631.1.16561 WP_004198631.1.16625 WP_004198631.1.16680 WP_004198631.1.16689 WP_004198631.1.16749 WP_004198631.1.17067 WP_004198631.1.17068 WP_004198631.1.17278 WP_004198631.1.17473 WP_004198631.1.17748 WP_004198631.1.17786 WP_004198631.1.18058 WP_004198631.1.18396 WP_004198631.1.18405 WP_004198631.1.18471 WP_004198631.1.18549 WP_004198631.1.18631 WP_004198631.1.18669 WP_004198631.1.18704 WP_004198631.1.18744 WP_004198631.1.18868 WP_004198631.1.18906 WP_004198631.1.19401 WP_004198631.1.19486 WP_004198631.1.19540 WP_004198631.1.19629 WP_004198631.1.1976 WP_004198631.1.19815 WP_004198631.1.19842 WP_004198631.1.20021 WP_004198631.1.20246 WP_004198631.1.20501 WP_004198631.1.20520 WP_004198631.1.20531 WP_004198631.1.20954 WP_004198631.1.21147 WP_004198631.1.21205 WP_004198631.1.21291 WP_004198631.1.21304 WP_004198631.1.21409 WP_004198631.1.21442 WP_004198631.1.21461 WP_004198631.1.21653 WP_004198631.1.21809 WP_004198631.1.21907 WP_004198631.1.22046 WP_004198631.1.22299 WP_004198631.1.22308 WP_004198631.1.22329 WP_004198631.1.2261 WP_004198631.1.22625 WP_004198631.1.23009 WP_004198631.1.23086 WP_004198631.1.23104 WP_004198631.1.23131 WP_004198631.1.2317 WP_004198631.1.23385 WP_004198631.1.23743 WP_004198631.1.23852 WP_004198631.1.23994 WP_004198631.1.2404 WP_004198631.1.24134 WP_004198631.1.24314 WP_004198631.1.24372 WP_004198631.1.24454 WP_004198631.1.24513 WP_004198631.1.2462 WP_004198631.1.24701 WP_004198631.1.25068 WP_004198631.1.25102 WP_004198631.1.25138 WP_004198631.1.25412 WP_004198631.1.25628 WP_004198631.1.25728 WP_004198631.1.259 WP_004198631.1.26054 WP_004198631.1.26445 WP_004198631.1.26502 WP_004198631.1.26535 WP_004198631.1.26565 WP_004198631.1.26633 WP_004198631.1.26645 WP_004198631.1.267 WP_004198631.1.26838 WP_004198631.1.26849 WP_004198631.1.27064 WP_004198631.1.27069 WP_004198631.1.27146 WP_004198631.1.27363 WP_004198631.1.27390 WP_004198631.1.27399 WP_004198631.1.27420 WP_004198631.1.27441 WP_004198631.1.27597 WP_004198631.1.27810 WP_004198631.1.27909 WP_004198631.1.28018 WP_004198631.1.28066 WP_004198631.1.28187 WP_004198631.1.28453 WP_004198631.1.28594 WP_004198631.1.28619 WP_004198631.1.28632 WP_004198631.1.29148 WP_004198631.1.29161 WP_004198631.1.29178 WP_004198631.1.29335 WP_004198631.1.29405 WP_004198631.1.29508 WP_004198631.1.29520 WP_004198631.1.29547 WP_004198631.1.29658 WP_004198631.1.29853 WP_004198631.1.29878 WP_004198631.1.29887 WP_004198631.1.29899 WP_004198631.1.29948 WP_004198631.1.30311 WP_004198631.1.30382 WP_004198631.1.3041 WP_004198631.1.30671 WP_004198631.1.3069 WP_004198631.1.30729 WP_004198631.1.30937 WP_004198631.1.30966 WP_004198631.1.31343 WP_004198631.1.31723 WP_004198631.1.31831 WP_004198631.1.32174 WP_004198631.1.32182 WP_004198631.1.32221 WP_004198631.1.324 WP_004198631.1.3251 WP_004198631.1.3273 WP_004198631.1.32951 WP_004198631.1.33077 WP_004198631.1.33087 WP_004198631.1.33130 WP_004198631.1.33157 WP_004198631.1.33158 WP_004198631.1.33165 WP_004198631.1.332 WP_004198631.1.33366 WP_004198631.1.33419 WP_004198631.1.33493 WP_004198631.1.33543 WP_004198631.1.33573 WP_004198631.1.33779 WP_004198631.1.34230 WP_004198631.1.34393 WP_004198631.1.34564 WP_004198631.1.34747 WP_004198631.1.35025 WP_004198631.1.35052 WP_004198631.1.35090 WP_004198631.1.35141 WP_004198631.1.35227 WP_004198631.1.35249 WP_004198631.1.35474 WP_004198631.1.35485 WP_004198631.1.35491 WP_004198631.1.35757 WP_004198631.1.35825 WP_004198631.1.35878 WP_004198631.1.36106 WP_004198631.1.36174 WP_004198631.1.36259 WP_004198631.1.36527 WP_004198631.1.366 WP_004198631.1.36662 WP_004198631.1.36666 WP_004198631.1.36944 WP_004198631.1.37 WP_004198631.1.3706 WP_004198631.1.37373 WP_004198631.1.37428 WP_004198631.1.37446 WP_004198631.1.37517 WP_004198631.1.37519 WP_004198631.1.37535 WP_004198631.1.37581 WP_004198631.1.37622 WP_004198631.1.37627 WP_004198631.1.37690 WP_004198631.1.37702 WP_004198631.1.37725 WP_004198631.1.37806 WP_004198631.1.37934 WP_004198631.1.37959 WP_004198631.1.37994 WP_004198631.1.38115 WP_004198631.1.38442 WP_004198631.1.38490 WP_004198631.1.38683 WP_004198631.1.3872 WP_004198631.1.38810 WP_004198631.1.38946 WP_004198631.1.39078 WP_004198631.1.39162 WP_004198631.1.39179 WP_004198631.1.39349 WP_004198631.1.3947 WP_004198631.1.39595 WP_004198631.1.39757 WP_004198631.1.39898 WP_004198631.1.40021 WP_004198631.1.40045 WP_004198631.1.40191 WP_004198631.1.40235 WP_004198631.1.40275 WP_004198631.1.40388 WP_004198631.1.40390 WP_004198631.1.40426 WP_004198631.1.40448 WP_004198631.1.4077 WP_004198631.1.41477 WP_004198631.1.41588 WP_004198631.1.41945 WP_004198631.1.42408 WP_004198631.1.42492 WP_004198631.1.42496 WP_004198631.1.42800 WP_004198631.1.43136 WP_004198631.1.43156 WP_004198631.1.43373 WP_004198631.1.43542 WP_004198631.1.43581 WP_004198631.1.43587 WP_004198631.1.43678 WP_004198631.1.43727 WP_004198631.1.43786 WP_004198631.1.43899 WP_004198631.1.44179 WP_004198631.1.44234 WP_004198631.1.44352 WP_004198631.1.44414 WP_004198631.1.44540 WP_004198631.1.44824 WP_004198631.1.45284 WP_004198631.1.45348 WP_004198631.1.45356 WP_004198631.1.45537 WP_004198631.1.45715 WP_004198631.1.45890 WP_004198631.1.4631 WP_004198631.1.46575 WP_004198631.1.46757 WP_004198631.1.46829 WP_004198631.1.4693 WP_004198631.1.46969 WP_004198631.1.47086 WP_004198631.1.47149 WP_004198631.1.4718 WP_004198631.1.47564 WP_004198631.1.48093 WP_004198631.1.4810 WP_004198631.1.48165 WP_004198631.1.48313 WP_004198631.1.48407 WP_004198631.1.48464 WP_004198631.1.49026 WP_004198631.1.49717 WP_004198631.1.49872 WP_004198631.1.50174 WP_004198631.1.50320 WP_004198631.1.50336 WP_004198631.1.50401 WP_004198631.1.50636 WP_004198631.1.50788 WP_004198631.1.50839 WP_004198631.1.51606 WP_004198631.1.51666 WP_004198631.1.5173 WP_004198631.1.5182 WP_004198631.1.51874 WP_004198631.1.51891 WP_004198631.1.51902 WP_004198631.1.52229 WP_004198631.1.52365 WP_004198631.1.52407 WP_004198631.1.52451 WP_004198631.1.52521 WP_004198631.1.52547 WP_004198631.1.52643 WP_004198631.1.52655 WP_004198631.1.52731 WP_004198631.1.52760 WP_004198631.1.52882 WP_004198631.1.5292 WP_004198631.1.53034 WP_004198631.1.53048 WP_004198631.1.53103 WP_004198631.1.53132 WP_004198631.1.53282 WP_004198631.1.5338 WP_004198631.1.53386 WP_004198631.1.53506 WP_004198631.1.53578 WP_004198631.1.53977 WP_004198631.1.54016 WP_004198631.1.5413 WP_004198631.1.54312 WP_004198631.1.54369 WP_004198631.1.54804 WP_004198631.1.54859 WP_004198631.1.54892 WP_004198631.1.55038 WP_004198631.1.55415 WP_004198631.1.55974 WP_004198631.1.55996 WP_004198631.1.5608 WP_004198631.1.56126 WP_004198631.1.56248 WP_004198631.1.5641 WP_004198631.1.56451 WP_004198631.1.56458 WP_004198631.1.56591 WP_004198631.1.56744 WP_004198631.1.56949 WP_004198631.1.56993 WP_004198631.1.57046 WP_004198631.1.57096 WP_004198631.1.57247 WP_004198631.1.5734 WP_004198631.1.57341 WP_004198631.1.57359 WP_004198631.1.57679 WP_004198631.1.5776 WP_004198631.1.58003 WP_004198631.1.58105 WP_004198631.1.58190 WP_004198631.1.58355 WP_004198631.1.58362 WP_004198631.1.58390 WP_004198631.1.58405 WP_004198631.1.58509 WP_004198631.1.58523 WP_004198631.1.58578 WP_004198631.1.58639 WP_004198631.1.58758 WP_004198631.1.5883 WP_004198631.1.59103 WP_004198631.1.59200 WP_004198631.1.59255 WP_004198631.1.59422 WP_004198631.1.59496 WP_004198631.1.59519 WP_004198631.1.59536 WP_004198631.1.59549 WP_004198631.1.59747 WP_004198631.1.60398 WP_004198631.1.60769 WP_004198631.1.60810 WP_004198631.1.60833 WP_004198631.1.60836 WP_004198631.1.60969 WP_004198631.1.61073 WP_004198631.1.61084 WP_004198631.1.61202 WP_004198631.1.61455 WP_004198631.1.61588 WP_004198631.1.61685 WP_004198631.1.61723 WP_004198631.1.61854 WP_004198631.1.6186 WP_004198631.1.61900 WP_004198631.1.62103 WP_004198631.1.62183 WP_004198631.1.62774 WP_004198631.1.63097 WP_004198631.1.63261 WP_004198631.1.63361 WP_004198631.1.63379 WP_004198631.1.63505 WP_004198631.1.63661 WP_004198631.1.63719 WP_004198631.1.63942 WP_004198631.1.64068 WP_004198631.1.64096 WP_004198631.1.64166 WP_004198631.1.64364 WP_004198631.1.64383 WP_004198631.1.64542 WP_004198631.1.64683 WP_004198631.1.64892 WP_004198631.1.65093 WP_004198631.1.65270 WP_004198631.1.65468 WP_004198631.1.65832 WP_004198631.1.65994 WP_004198631.1.66257 WP_004198631.1.66465 WP_004198631.1.66594 WP_004198631.1.67013 WP_004198631.1.67117 WP_004198631.1.67182 WP_004198631.1.67229 WP_004198631.1.67393 WP_004198631.1.67559 WP_004198631.1.6765 WP_004198631.1.67860 WP_004198631.1.67909 WP_004198631.1.67914 WP_004198631.1.67978 WP_004198631.1.6835 WP_004198631.1.68353 WP_004198631.1.68515 WP_004198631.1.68664 WP_004198631.1.68886 WP_004198631.1.68922 WP_004198631.1.69022 WP_004198631.1.69081 WP_004198631.1.69094 WP_004198631.1.69106 WP_004198631.1.69169 WP_004198631.1.69217 WP_004198631.1.69354 WP_004198631.1.69508 WP_004198631.1.69770 WP_004198631.1.70016 WP_004198631.1.7006 WP_004198631.1.70066 WP_004198631.1.70096 WP_004198631.1.70278 WP_004198631.1.70280 WP_004198631.1.70735 WP_004198631.1.71392 WP_004198631.1.71444 WP_004198631.1.71564 WP_004198631.1.71901 WP_004198631.1.72015 WP_004198631.1.72083 WP_004198631.1.72545 WP_004198631.1.72798 WP_004198631.1.72817 WP_004198631.1.73317 WP_004198631.1.73418 WP_004198631.1.73521 WP_004198631.1.73576 WP_004198631.1.73974 WP_004198631.1.74177 WP_004198631.1.74425 WP_004198631.1.7450 WP_004198631.1.74569 WP_004198631.1.74675 WP_004198631.1.74690 WP_004198631.1.75001 WP_004198631.1.75027 WP_004198631.1.75230 WP_004198631.1.75276 WP_004198631.1.75519 WP_004198631.1.75677 WP_004198631.1.75708 WP_004198631.1.75711 WP_004198631.1.75776 WP_004198631.1.75861 WP_004198631.1.75883 WP_004198631.1.75913 WP_004198631.1.75937 WP_004198631.1.76142 WP_004198631.1.76290 WP_004198631.1.76432 WP_004198631.1.76522 WP_004198631.1.76575 WP_004198631.1.766 WP_004198631.1.7703 WP_004198631.1.77249 WP_004198631.1.77287 WP_004198631.1.77319 WP_004198631.1.77689 WP_004198631.1.77788 WP_004198631.1.77845 WP_004198631.1.78029 WP_004198631.1.78278 WP_004198631.1.78506 WP_004198631.1.78557 WP_004198631.1.78628 WP_004198631.1.78759 WP_004198631.1.78807 WP_004198631.1.78827 WP_004198631.1.79052 WP_004198631.1.79360 WP_004198631.1.795 WP_004198631.1.79653 WP_004198631.1.79689 WP_004198631.1.79710 WP_004198631.1.79725 WP_004198631.1.79782 WP_004198631.1.80098 WP_004198631.1.80302 WP_004198631.1.80395 WP_004198631.1.80433 WP_004198631.1.80614 WP_004198631.1.80923 WP_004198631.1.81042 WP_004198631.1.8126 WP_004198631.1.81479 WP_004198631.1.81511 WP_004198631.1.81543 WP_004198631.1.81665 WP_004198631.1.82197 WP_004198631.1.82283 WP_004198631.1.82323 WP_004198631.1.82394 WP_004198631.1.82506 WP_004198631.1.82575 WP_004198631.1.82694 WP_004198631.1.82727 WP_004198631.1.82915 WP_004198631.1.82950 WP_004198631.1.83080 WP_004198631.1.83357 WP_004198631.1.8341 WP_004198631.1.83487 WP_004198631.1.83543 WP_004198631.1.83567 WP_004198631.1.83609 WP_004198631.1.83688 WP_004198631.1.8388 WP_004198631.1.8390 WP_004198631.1.8395 WP_004198631.1.83967 WP_004198631.1.84002 WP_004198631.1.84026 WP_004198631.1.84063 WP_004198631.1.84181 WP_004198631.1.84375 WP_004198631.1.84379 WP_004198631.1.84480 WP_004198631.1.84654 WP_004198631.1.84866 WP_004198631.1.85170 WP_004198631.1.85412 WP_004198631.1.85443 WP_004198631.1.85467 WP_004198631.1.85490 WP_004198631.1.85565 WP_004198631.1.85584 WP_004198631.1.856 WP_004198631.1.85641 WP_004198631.1.85645 WP_004198631.1.85774 WP_004198631.1.8585 WP_004198631.1.8629 WP_004198631.1.86295 WP_004198631.1.86438 WP_004198631.1.86525 WP_004198631.1.86806 WP_004198631.1.86872 WP_004198631.1.8697 WP_004198631.1.87114 WP_004198631.1.87278 WP_004198631.1.87324 WP_004198631.1.87553 WP_004198631.1.87652 WP_004198631.1.87759 WP_004198631.1.87811 WP_004198631.1.88003 WP_004198631.1.88117 WP_004198631.1.88168 WP_004198631.1.88237 WP_004198631.1.88322 WP_004198631.1.88369 WP_004198631.1.88666 WP_004198631.1.88682 WP_004198631.1.88764 WP_004198631.1.88920 WP_004198631.1.8912 WP_004198631.1.89240 WP_004198631.1.89435 WP_004198631.1.89514 WP_004198631.1.89782 WP_004198631.1.90079 WP_004198631.1.90471 WP_004198631.1.9079 WP_004198631.1.90934 WP_004198631.1.91025 WP_004198631.1.91142 WP_004198631.1.91198 WP_004198631.1.91700 WP_004198631.1.91709 WP_004198631.1.91823 WP_004198631.1.92095 WP_004198631.1.9236 WP_004198631.1.92367 WP_004198631.1.92406 WP_004198631.1.92430 WP_004198631.1.92493 WP_004198631.1.92507 WP_004198631.1.9280 WP_004198631.1.9281 WP_004198631.1.92904 WP_004198631.1.93845 WP_004198631.1.94023 WP_004198631.1.94050 WP_004198631.1.94117 WP_004198631.1.94121 WP_004198631.1.94286 WP_004198631.1.94498 WP_004198631.1.94520 WP_004198631.1.9479 WP_004198631.1.94901 WP_004198631.1.95054 WP_004198631.1.95300 WP_004198631.1.95339 WP_004198631.1.9537 WP_004198631.1.95420 WP_004198631.1.95587 WP_004198631.1.95644 WP_004198631.1.95672 WP_004198631.1.95938 WP_004198631.1.95952 WP_004198631.1.96381 WP_004198631.1.96660 WP_004198631.1.97058 WP_004198631.1.97112 WP_004198631.1.97989 WP_004198631.1.98066 WP_004198631.1.98218 WP_004198631.1.98316 WP_004198631.1.98491 WP_004198631.1.98547 WP_004198631.1.98688 WP_004198631.1.98713 WP_004198631.1.98753 WP_004198631.1.98768 WP_004198631.1.98944 WP_004198631.1.99061 WP_004198631.1.99069 WP_004198631.1.99160 WP_004198631.1.99233 WP_004198631.1.99290 WP_004198631.1.9962 WP_004198631.1.99629 WP_004198631.1.99741 WP_004198631.1.9975 WP_004198631.1.9983 WP_004198631.1.99890 WP_004198631.1.99919 YP_104351.1.87047 YP_109884.1.59693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]